(data stored in ACNUC7421 zone)

EMBL: CP001053.PE507

CP001053.PE507       Location/Qualifiers
FT   CDS_pept        complement(578213..579142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4509"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   bxe:Bxe_B0827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4509"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18882"
FT                   /db_xref="GOA:B2TGS1"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS1"
FT                   /protein_id="ACD18882.1"
FT                   /translation="MNHEVIVTCAVTGAGDTVGKHPAIPVTPKQIAEAAIEAAKAGATV
FT                   AHCHVRDPKTGRGSRDPQLYREVVDRIRSSGTDVIINLTAGMGGDLEIGPGEDPMRFGA
FT                   NTDLVGGLTRLAHVEELLPEICTLDCGTLNFGDGDYIYVSTPAQLRAGARRIQELGVKP
FT                   ELEIFDTGHLWFAKQLLKEGLLDAPPLFQICLGIPWGAPADTTTMKAMADNLPPGAQWA
FT                   GFGIGRMQMPMVAQAMLLGGHVRVGLEDNIWLDKGVPATNGTLVQRAVEIIERLGARAL
FT                   TPAEGRRKLGLPARGERQLERREAGQYA"
     atgaatcatg aagtcatcgt gacctgtgcg gtcaccggcg caggcgatac cgtcggcaag        60
     cacccggcca ttcccgtcac gccgaagcag attgccgagg ccgccatcga agccgcgaaa       120
     gccggcgcga ccgttgcgca ctgccacgtg cgcgatccga aaaccggacg cggcagccgc       180
     gatccgcaac tgtatcgcga ggtggtcgac cgtatccgct cgtcgggcac ggacgtgatc       240
     atcaacctga cggccggcat gggcggcgat ctggagatcg gtccgggcga agatccgatg       300
     cgcttcggcg cgaacacgga tctggtcggc ggcctcacgc gcctcgcgca tgttgaggaa       360
     ttgctgccgg aaatctgcac gctcgactgc ggcacgctga atttcggcga cggcgactac       420
     atctacgtgt cgacacccgc gcagttacgg gccggcgcgc ggcgcatcca ggaactcggc       480
     gtcaagcctg aactggaaat cttcgacacc gggcatttgt ggttcgcgaa gcaactgctc       540
     aaggaaggcc tgctcgatgc gccgccgctg ttccagatat gcctcggcat tccctggggc       600
     gcgcccgccg acaccaccac catgaaagcg atggccgata acctgccgcc cggcgcgcaa       660
     tgggccggct tcggcatcgg ccgcatgcag atgccgatgg tcgcgcaggc gatgctgctc       720
     ggcggccacg tgcgcgtggg cctcgaagac aacatctggc tcgataaagg cgtgcccgca       780
     acgaacggca cgctggtgca acgcgcggtg gaaatcatcg aacggctcgg cgcacgcgcg       840
     ctgacgcctg ccgaggggcg ccgcaaactg ggtctgcccg cgcgtggcga gcgtcagttg       900
     gagcggcgcg aggcgggaca gtacgcttga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page