(data stored in ACNUC7421 zone)

EMBL: CP001053.PE513

CP001053.PE513       Location/Qualifiers
FT   CDS_pept        complement(582910..584700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4515"
FT                   /product="Sulfite reductase (ferredoxin)"
FT                   /EC_number="1.8.7.1"
FT                   /note="PFAM: nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; KEGG: bxe:Bxe_B0922
FT                   putative nitrite/sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4515"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18888"
FT                   /db_xref="GOA:B2TGS7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS7"
FT                   /protein_id="ACD18888.1"
FT                   /translation="MYQYTEFDQSFVRSRAAQFRDQLERWQSGKLSEDDFRPLRLQNGW
FT                   YVQRHAPMLRVAIPYGELSSRQLRMLARIAREYDEPEAEVYRLASEAQRKLGTVRLPTN
FT                   YAHFTTRTNVQFNWIPLSKAADVMDLLASVDMHGIQTSGNCIRNISCDERAGVAPDEIA
FT                   DPRPFAEIMRQWTTLHPEFAFLPRKFKIAITGASEDRAATDWHDVGLRLLRNEAGELGF
FT                   RVTVGGGMGRTPVIGTVLREFLPWQHIMNYIEAVVRVYNQYGRRDNKYKARIKILVKAE
FT                   GQRYIDGVEEEFRQIVEHDGGPHTIPLAELERVSACFALPSRPSVDAPIDLEAIATSNA
FT                   VALETPQFERWLQRNVSPHRNQRLRIVTLSFKRLLQAPGDASAEQLDRVADLAERFSAG
FT                   EARVTHTQNVVLPWVHVNDLLPLWQAAREAGLASANVNLLTDMIACPGGDFCALANARS
FT                   IPVAEAITERYQDLDELNDIGDIDLHISGCINSCGHHHSGHIGILGVDKDGKEWYQVTL
FT                   GGSDGSHASGRAQAGKVIGPSFSAAEVPEVIDALLSAYLDIRAAVGGRRESFVETVRRA
FT                   GIEPFRTAADRVRTLMEKTA"
     atgtaccaat acaccgagtt tgaccaatca ttcgtgcgca gccgcgctgc gcagtttcgc        60
     gaccagctcg aacgctggca gtccggcaag ctgagcgagg acgactttcg tccgttgcgt       120
     cttcagaacg gctggtacgt gcaacggcat gcgccgatgc tgcgcgtggc gatcccctac       180
     ggcgagttgt cgagcaggca gttgcgcatg ctcgcccgga ttgcacgcga atacgacgag       240
     ccggaggccg aggtctaccg ccttgccagc gaggcgcagc gcaagctcgg caccgtccgc       300
     ctgcccacga actatgcgca tttcacgacg cgcaccaacg tgcagttcaa ctggattccg       360
     ctctcgaaag ccgcggacgt gatggacttg ctcgccagcg tggacatgca cggcattcag       420
     accagcggca attgcatccg caacatttcc tgcgacgaac gcgcgggcgt tgcgcccgac       480
     gaaattgccg acccgcgtcc gttcgctgaa atcatgcggc aatggacgac cctccatccc       540
     gagttcgcgt tcctgccgcg caagttcaag atcgcgatca ccggcgcgag cgaagaccgc       600
     gccgcgacgg actggcatga cgtcggcctt cgtctgctgc gaaacgaagc gggcgagctg       660
     ggatttcgcg tcacggtggg cggcggcatg ggccgcactc ccgtgatcgg cactgtgctg       720
     cgcgagtttt tgccatggca gcacatcatg aattacatcg aagcggtggt gcgcgtctac       780
     aaccagtacg gacgccgcga caataagtac aaggcgcgga tcaagattct ggtgaaggcg       840
     gaaggtcaac gttacatcga cggcgtcgaa gaagagttcc gccagattgt cgagcacgac       900
     ggcggtccgc atacgattcc gctggcggaa ctcgaacgcg tcagcgcgtg cttcgctcta       960
     ccctccaggc cttccgtgga tgcgccgatc gacctcgaag cgatcgcaac gtcgaacgcc      1020
     gtagcgctcg agacgccgca attcgaacgc tggctccagc gcaatgtctc gccgcacagg      1080
     aaccagcgct tgcggatcgt cacgctctcg ttcaaacggc ttctgcaagc acccggcgat      1140
     gcatcggcgg aacagctcga tcgcgtggcc gacctggccg agcggttctc ggcgggcgaa      1200
     gcgcgcgtca cccacacgca gaacgtcgtg ttgccgtggg tgcatgtcaa cgacctcctg      1260
     ccgctctggc aagccgcgcg cgaggcggga ctcgcgagcg ccaacgtgaa tctgctgacc      1320
     gacatgatcg cctgcccggg tggcgatttc tgtgcgctcg ccaatgcccg ttccattccg      1380
     gttgccgagg cgattaccga gcgctatcag gatctggacg aactcaatga catcggcgat      1440
     atcgatctgc atatcagcgg ctgcatcaat tcgtgcggcc atcatcatag cgggcacatc      1500
     ggcatcctcg gggtcgacaa ggatggcaag gaatggtacc aggtgacgtt gggcggctcg      1560
     gacggctcgc acgccagtgg tcgcgcgcag gcgggcaagg tcatcggccc gtcgttttcc      1620
     gccgctgagg tgccggaggt catcgacgcg ctgctgtctg cctatctcga cattcgggcg      1680
     gccgttggcg ggcggcgcga gtcgttcgtc gaaacggttc gacgggcagg catcgaaccg      1740
     ttcaggacag ctgcggatcg cgtacgcaca ctgatggaga aaacggcatg a               1791
//

If you have problems or comments...

PBIL Back to PBIL home page