(data stored in ACNUC7421 zone)

EMBL: CP001053.PE514

CP001053.PE514       Location/Qualifiers
FT   CDS_pept        585029..585217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4516"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18889"
FT                   /db_xref="GOA:B2TGS8"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS8"
FT                   /protein_id="ACD18889.1"
FT                   /translation="MDLLKMTRIVLWSFFGIRRGASHQADMAGVKLPLLPLVAVVLAAG
FT                   FGATLFALARLAVNVAH"
     atggacctct tgaagatgac gcgaatcgta ctgtggagtt tttttggcat tcgccgcggc        60
     gcctcgcatc aggccgacat ggcgggcgtc aagcttcccc tgctgccgct ggtcgcggta       120
     gttctcgccg ccggattcgg cgcgacgctg ttcgcactcg cgcggcttgc ggtcaacgtg       180
     gcgcattga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page