(data stored in ACNUC7421 zone)

EMBL: CP001053.PE515

CP001053.PE515       Location/Qualifiers
FT   CDS_pept        complement(585250..586665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4517"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bxe:Bxe_B0924 transcriptional
FT                   regulator, GntR family with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4517"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18890"
FT                   /db_xref="GOA:B2TGS9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS9"
FT                   /protein_id="ACD18890.1"
FT                   /translation="MKRFEMLANTMADEIRSGSRPVGSRMPSLRHLTTQHGVSQSTVFR
FT                   AYYLLEEWGLIRARERSGYYVAPGAALEHKPAPQPPAALESAKVEISDLVFSVLEAAKH
FT                   PNVVPFGSAFPSPQLFPLQRLARSLGHSSRLISPWSTVVDLPPGNEPLRRQISLRYMGM
FT                   GIAQPMEQLVVTNGALEALNLCLMAVTRPGDVVAIESPGFYAALQAIERLDLRAVEIPV
FT                   DPVSGIDLQALSDALDKHPIRACWFMTNYQNPTGAAMSQEKKKALVELLAERDVPLIED
FT                   DVYGELHHAATYPLPAIAFDTKGLVMHCSSFSKTLAPGYRIGWVAAGRFAEKVQRLKLM
FT                   TTLSASIPAQAAIADYLQHGGYDKHLRKLRGAFRNQLASMDTALRRYMPEDSHWTLPSG
FT                   GYFLWLRLPSHVDAMQLHRLALENGISIAPGPIFSARHEFRNHIRLNFGHPWSDNTESA
FT                   VQTLASLLEQASR"
     atgaaacgct tcgaaatgct ggccaacacc atggccgatg aaattcgctc gggcagccgg        60
     ccagtcggct cgcgtatgcc gtcgctgcgg catctcacca cacagcacgg cgtgagccag       120
     tccaccgtgt ttcgtgccta ttatctgctc gaagagtggg gcttgattcg agcacgcgaa       180
     cgctcgggct actacgtcgc gccgggcgcc gcgctcgaac acaaaccggc gccccaaccg       240
     ccagccgctc tggaatccgc caaggtcgag atcagcgatc tcgttttctc ggtgctcgaa       300
     gccgcgaagc atcccaatgt ggtgccgttc ggttcggcct ttccgtctcc gcaacttttt       360
     cccctccagc gtctggccag gtcgctcggg cattcgagcc gtttgatcag tccgtggagc       420
     accgtcgtcg atcttccgcc gggcaatgag ccgttgcgcc gccagatatc gttgcgttac       480
     atggggatgg gcattgccca gccgatggag cagcttgtcg tcaccaacgg cgcgctggaa       540
     gcattgaacc tgtgtttgat ggccgtcacg cgcccgggcg acgtggtcgc gatcgagtcg       600
     cccggattct atgcggccct gcaggccatc gagcgcctcg atctgcgggc ggtcgagatt       660
     ccagtcgatc ctgtgtcggg catcgatttg caagcgctct cggatgccct cgacaagcat       720
     cctatccgcg catgctggtt catgaccaac tatcagaatc cgaccggcgc ggcgatgtcg       780
     caggagaaga agaaagcgct ggtcgaactt ctcgccgaac gtgacgtgcc gcttatcgag       840
     gatgacgtgt acggcgaact gcatcacgcg gcgacctacc cgctgcccgc catcgccttc       900
     gacacgaaag ggctcgtgat gcactgcagt tcattttcga agacgctcgc tccgggatac       960
     cgcattggat gggtcgcggc gggacgcttc gccgagaagg tgcagcgcct gaagctgatg      1020
     accacgttgt cggccagcat tcccgcgcag gcagcgatag cggactatct tcagcacggc      1080
     gggtacgaca agcatctgcg gaaactgcgc ggcgcgttcc gcaatcaact cgcctcgatg      1140
     gacaccgcgc tgcgccgcta catgccggag gattcgcatt ggacgctgcc gtccggaggc      1200
     tattttctgt ggctgcggct gccgtcgcat gtcgacgcga tgcaattgca ccgccttgcg      1260
     ctagagaacg gcatcagcat cgcgccgggt ccgatcttct ccgcgcggca cgaattccgg      1320
     aatcatatcc gcttgaactt cggtcatccg tggagcgaca acacggagag cgctgtccaa      1380
     acactggcct cgctgctcga gcaggcgagc cgataa                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page