(data stored in ACNUC7421 zone)

EMBL: CP001053.PE518

CP001053.PE518       Location/Qualifiers
FT   CDS_pept        589765..591270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4520"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bxe:Bxe_B0835 transcriptional
FT                   regulator, GntR family, with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4520"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18893"
FT                   /db_xref="GOA:B2TGT2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGT2"
FT                   /protein_id="ACD18893.1"
FT                   /translation="MRASVLSDWLAQRLDRGNGQPIYRQLHRLLQQAILSRELPPGSKV
FT                   PSSRLLAQELGIGRNTVTQVYEQLVLEGYVSSATGRGTFVADSAPDEIVGVPDAEAPAA
FT                   RSEPAPQQARRALSTRGARLIAGAGVSKRQWGAFMPGVPDVTKFPARVWSRLHNKYWRR
FT                   LRPDLLTYAPGGGLASLRHALADYLRTSRSVRCTPEQIIITTGIHQSVDLAVRLLSDPG
FT                   DVIWTEDPCYWGVRSVLHVSGLESRPIAVDEEGINPSADDLAQPPKLMLVTPSHQYPLG
FT                   MVMSLARRRMLLEYARQNLCWIIEDDYDSEYRYGSRPLASLQGLDTSGQVIYVGSFGKT
FT                   LFPGLRIGYLVVPEALAESFATASAELYREGQLLQQAMLAEFIAEGHFTSHIRKMRTLY
FT                   GQRRQTLLDAAAQRYGDALPAVGGDAGLHLVMQLPDGTDDRRVAAAALERNIVVRPLSG
FT                   YYAQPALAPSGLLIGYACVPDEEIAPAFNTLADAIDATLPEFV"
     atgcgcgcga gcgttttgtc cgactggctg gcccagcgcc tcgatcgggg caacggtcag        60
     ccgatttatc gtcagttgca ccggctgttg cagcaggcga tcctgtcgcg cgaattgccg       120
     ccgggcagca aggtgccgtc gtcgcgcttg ttggcgcagg agttgggcat tgggcgcaac       180
     actgtcacgc aggtgtatga gcaactcgta ctcgaagggt atgtcagttc ggcgaccggg       240
     cgcggcacgt ttgtcgccga tagcgcgccg gacgagatcg tcggtgtgcc cgacgccgag       300
     gcgcccgccg cgcgttccga gccggcgccg cagcaggcgc ggcgcgcgct gtccacgcgc       360
     ggcgcgcggc taattgcggg agcgggtgtg tccaagcggc agtggggcgc gttcatgcct       420
     ggcgtgcccg acgtcacgaa gtttccggcg cgcgtctgga gccgtctgca caataaatat       480
     tggcggcggc tgcgcccgga cctgctgacg tatgcgccgg gtggcggcct ggcttcgctg       540
     cggcatgcgc tggcggacta tctgcgcact tcgcgctcag tgcgctgcac gccggagcag       600
     atcatcatca cgaccgggat tcaccagtcg gtcgatctgg ccgtgcgcct gctatccgat       660
     cctggcgacg tgatctggac cgaagacccg tgttattggg gcgtgcgcag cgtgctgcac       720
     gtgtcgggtc tggaatcgcg gccgatcgcc gtcgacgagg aaggcatcaa tccttccgcc       780
     gacgacctcg cgcagccgcc gaaactgatg ctcgtcacgc cttcgcacca atatccgctc       840
     ggcatggtga tgagtctcgc gcgacgccgc atgctgctcg aatacgcgcg gcagaacctg       900
     tgctggatca tcgaggacga ttacgacagc gaataccgct atggcagcag gccgttggct       960
     tcgctgcaag gtctggatac gtcggggcag gtgatttacg tgggcagctt cggcaagacg      1020
     ttgtttccgg ggttgcgcat cggctacctc gtggtgccgg aagcgctggc ggagagcttt      1080
     gccactgcga gcgccgagtt gtatcgcgag gggcaactgc tgcagcaggc gatgctcgcg      1140
     gagttcatcg ccgaaggtca tttcacgtcg catatccgca agatgcgcac gctgtacgga      1200
     caacgcaggc agacgctgct ggatgccgcc gcgcagcgtt acggcgacgc gttgcccgca      1260
     gtcggcggcg acgccggttt gcatctagta atgcagttgc ctgatggcac cgatgaccgg      1320
     cgggtggcgg ctgcggcgtt ggagcgcaat atcgtcgtgc ggccgttgtc gggctactac      1380
     gcgcagccgg cgttggcgcc gtcgggtttg ctgatcggct acgcgtgcgt gccggatgag      1440
     gaaatcgcgc cggctttcaa cacgctggct gacgcgatcg atgcgacgtt gccggagttt      1500
     gtgtga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page