(data stored in ACNUC7421 zone)

EMBL: CP001053.PE522

CP001053.PE522       Location/Qualifiers
FT   CDS_pept        complement(594255..595178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4524"
FT                   /product="phosphonate ABC transporter, ATPase subunit"
FT                   /note="KEGG: bxe:Bxe_B0839 ABC phophonates transporter,
FT                   ATPase subunit PhnC; TIGRFAM: phosphonate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4524"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18897"
FT                   /db_xref="GOA:B2TGT6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGT6"
FT                   /protein_id="ACD18897.1"
FT                   /translation="MHQGVLMETIREAIRIERLSKTFSNGRKALDEIDLRVEPGEMVAL
FT                   IGASGSGKSTLLRHIAGFTASDAQPSQISILGRPIQQNGRIVREVRSIRRDIGFVFQQF
FT                   NLVNRLSVESNVLIGALARLPLWRRLSGRFPRAERALSMAALNEVGIGEHARERAANLS
FT                   GGQQQRAALARALVQRARIVLADEPIASLDPESSRRVMEMLRTLNVEHQLTVLVSLHQV
FT                   DIAMQYCPRTIALRRGKVVYDGPSAALTPVLLKKLYGDDARELLDAAPISAEDLDTKTV
FT                   NGSTPAQSTAPASTRYAFALNPAHSN"
     atgcatcaag gggtactcat ggaaacaatt cgggaagcaa ttcgtatcga acggttgagc        60
     aagacgttca gcaacggccg caaggcgttg gacgaaatcg atctgcgcgt cgaaccgggt       120
     gaaatggttg cgttgatcgg cgcctcgggc tcgggcaagt cgacgctgct gcgtcatatc       180
     gcgggtttca cggcttcgga tgcgcagccg tcgcagatct cgattctggg ccggccgatt       240
     cagcagaatg gccgcatcgt gcgggaagtg cgcagcattc gccgcgatat cggcttcgtg       300
     ttccagcaat tcaatctggt aaaccggctc tccgtcgaaa gcaacgtgct gatcggcgcg       360
     ctcgcgcggc tgccgttgtg gcgccgactt agcggccgtt ttccacgcgc tgagcgggcg       420
     ttatcgatgg ccgcgttgaa cgaggtcggc attggcgaac atgcgcgcga acgcgccgcc       480
     aatctctccg gcggccagca gcagcgcgcc gcgctcgccc gtgcactggt gcagcgcgcg       540
     cgcatcgtgc tcgcggacga accgatcgcc tcgctcgacc ccgagtcgtc acgccgcgtg       600
     atggagatgc tacgcacgct gaacgtcgag catcaactca cggtgctggt gtcgctgcat       660
     caggtcgaca tcgcgatgca gtactgcccg cgcacgattg cgctgcgccg cggcaaggtg       720
     gtgtacgacg gcccttccgc cgcactcacg ccggtcttgc tcaagaaact ctacggcgac       780
     gacgcccgcg aactactcga tgcagccccc atcagcgcgg aagatctcga cacaaaaacc       840
     gttaacggca gcacgcccgc tcagagcacc gcgcccgcct cgacgcgcta cgccttcgca       900
     ctcaatccgg cgcactcgaa ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page