(data stored in ACNUC7421 zone)

EMBL: CP001053.PE526

CP001053.PE526       Location/Qualifiers
FT   CDS_pept        602492..603397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4528"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   bxe:Bxe_B0843 heavy metal/H+ antiporter, CDF family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4528"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18901"
FT                   /db_xref="GOA:B2TGU0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR040177"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGU0"
FT                   /protein_id="ACD18901.1"
FT                   /translation="MKEESPKAIFYALAANLGIAICKFAAAAFTGSGSMFAEAIHSTAD
FT                   CGNQLLLLFGLREARKPASPLHPMGGGREINFYSLLVALLLFFVGGAFSVYEGVHRLFV
FT                   REPLQYAYVALAVLGVSVVLEALSLWGAVKEIRKTHPDKSMWRWFRETRESELLVVAGE
FT                   DIAALAGLAMAFAAVLLTMMTGNPVYDALGSIGVGVLLMVIAWLVAREVKSMIVGESAS
FT                   PEVRRAIEAHLRGRTEIRSIINMITLQWGRHVVVAVQAEMIDYASGRAMVDAINVIEAD
FT                   LQATFPQVRWVFFEPEVPRV"
     atgaaagaag aatcgccgaa agccattttc tatgcgctcg ccgccaacct cggcattgcc        60
     atctgcaagt tcgcggccgc cgcgttcacc ggttccggct cgatgttcgc cgaggccatt       120
     cactccactg ctgattgcgg aaatcaattg ctgctgctgt tcggtctgcg tgaagcgcgc       180
     aagccggcga gcccgttgca tcccatgggc ggcgggcgag agatcaactt ctattcgctt       240
     ctggtcgcgc ttctgctgtt ctttgtcggc ggtgcgttct ctgtgtatga gggcgtgcat       300
     cgtctgttcg tgcgcgagcc gttgcagtac gcctatgtgg cgctggcggt gctcggcgtg       360
     tccgtggtgc tggaggcgct ttccttgtgg ggcgccgtca aggaaatccg caagacgcat       420
     cccgacaaaa gcatgtggcg ctggtttcgg gagacgcgtg aatccgaact cctcgtggta       480
     gcgggcgagg atatcgccgc gctggcgggc ctggcgatgg ccttcgcggc cgtgctgctc       540
     accatgatga ccggcaatcc tgtctacgac gcattgggtt ccatcggcgt cggcgtgttg       600
     ctgatggtga tcgcgtggct ggtggcgcgt gaagtgaaat cgatgatcgt cggcgaatcg       660
     gcgagccccg aagtgcggcg cgctatcgag gcgcatctgc gcgggcgcac cgagattcgc       720
     agcatcatca atatgattac gctgcaatgg gggcgtcatg tggtggtggc ggtgcaggcg       780
     gaaatgatcg actacgcgag cggccgcgcg atggtcgatg cgatcaacgt gatcgaagcg       840
     gacttgcagg ccacgttccc gcaagtccgc tgggtgttct tcgaaccgga ggtgccgcgc       900
     gtttga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page