(data stored in ACNUC7421 zone)

EMBL: CP001053.PE529

CP001053.PE529       Location/Qualifiers
FT   CDS_pept        complement(605924..606232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4531"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18904"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGU3"
FT                   /protein_id="ACD18904.1"
FT                   /translation="MKRNLLAGLALSLLVSAPVFAQSSSGGIGRAGSYNTQPAPTTTAK
FT                   SREEVKAELVAAYRDGSLPALNRTTYPNKGLIGQTQAERIARQEGTSGDVTRVANGQ"
     atgaaacgca atctcttagc aggtctggct ctttcgctgc tcgtgagcgc cccggtgttt        60
     gcacaaagca gcagcggcgg cattggccgc gccggctcgt acaacacgca acccgcgccg       120
     accacgaccg cgaagtcgcg tgaagaagtg aaggccgaac tggtcgcagc gtatcgcgac       180
     ggctcgttgc ccgcgctgaa tcgcacgacg tatccgaaca aaggcctgat cggtcaaacc       240
     caggctgaac gcatcgcgcg gcaggaaggc acgagcggcg acgttacgcg tgtggccaac       300
     ggacagtaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page