(data stored in ACNUC7421 zone)

EMBL: CP001053.PE53

CP001053.PE53        Location/Qualifiers
FT   CDS_pept        58278..58511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bps:BPSL1298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4043"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18428"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA7"
FT                   /protein_id="ACD18428.1"
FT                   /translation="MSSIYYAGCKARIKNLELAWDDAEPSLKPRAGADWHKVDKAIDRA
FT                   LSALRASAPSAVECKQSLADLMAVMDRMSGKV"
     gtgagttcga tctattacgc cggctgcaag gcgcgcatca agaacctcga actcgcgtgg        60
     gacgacgccg agccgtcgct gaagccgcgc gccggcgcgg actggcataa ggtcgataaa       120
     gcaatcgatc gcgcgctgag cgcgttgcgt gcgagtgcgc cgagtgcagt ggaatgcaaa       180
     cagtcgctcg ccgatctcat ggcggtcatg gatcgcatga gcggtaaagt ctga             234
//

If you have problems or comments...

PBIL Back to PBIL home page