(data stored in ACNUC7421 zone)

EMBL: CP001053.PE535

CP001053.PE535       Location/Qualifiers
FT   CDS_pept        615060..615899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4537"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: bxe:Bxe_B0852 ABC
FT                   methionine transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4537"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18910"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ3"
FT                   /protein_id="ACD18910.1"
FT                   /translation="MRIFLSTVQRFFHTPAVSLISAFGLALVLQATPASAADSPTLKIG
FT                   TATSPQIEALKIAAREAKEQGLDVKIIEFTDWNTPNAALANKDIDVNYFQHIPFLENAK
FT                   KQGGYNFVAIAPGTIMKIGLYSKKIKRFDELKDGATVAIANDPVNGGRGLLLLQRAGLI
FT                   KLKPGIDYRATTLDIIDNPKHLKIVQLEASQLARSLDDVDLAQGYPSFIKLAGTTDPNS
FT                   ALLFDGLENKNYAIQWVVRPESANDPRIRKFIAIYQHSPAVRAALDKAFGNLYAVAW"
     atgcgcattt ttctgtccac cgtgcagcgc tttttccaca cgccggctgt ctcgctcatc        60
     agcgcgttcg gtctcgcgct cgtgttgcag gccacgcccg cttcagcggc cgactcgccc       120
     acgctgaaaa tcggcaccgc aaccagcccg caaatcgaag cgctcaaaat cgccgcgcgc       180
     gaagcgaaag agcagggcct cgacgtgaag atcatcgagt tcacggactg gaatacgccg       240
     aacgcggcgc tcgccaacaa ggacatcgat gtcaactact tccagcatat tccgtttctc       300
     gagaatgcga agaagcaggg cggctataac ttcgtcgcaa tcgcgccggg cacgatcatg       360
     aagatcggtc tgtattcgaa gaagatcaaa cgcttcgacg aattgaaaga cggcgcgacg       420
     gtcgcgatcg ccaacgaccc ggtcaacggc ggacgcggcc tgctattgct gcagcgcgcc       480
     ggcctcatca agctgaagcc gggcatcgac tatcgcgcga cgacgctcga catcatcgac       540
     aacccgaagc atctgaagat cgtgcagctg gaagcatcgc aactggcgcg ttcgctcgac       600
     gacgtcgatc tcgcacaggg ttacccgagt ttcatcaagc tcgccggcac caccgatccg       660
     aatagcgcgc tgctgttcga tggcctggaa aacaaaaact acgcgattca atgggtcgtg       720
     cgtccggaaa gcgcgaacga tccgcgtatc cgcaagttca ttgcgatcta tcagcattcg       780
     ccggcagtgc gcgccgcgct cgacaaagcc ttcggcaatc tctacgccgt cgcgtggtaa       840
//

If you have problems or comments...

PBIL Back to PBIL home page