(data stored in ACNUC7421 zone)

EMBL: CP001053.PE539

CP001053.PE539       Location/Qualifiers
FT   CDS_pept        619333..620535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4541"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: bxe:Bxe_B0855
FT                   putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4541"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18914"
FT                   /db_xref="GOA:B2TDZ7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ7"
FT                   /protein_id="ACD18914.1"
FT                   /translation="MNDPRHADALQTPQAFAESEVRDLAGLLDALRASAAQRDIDGGHA
FT                   AREKQWIADAGLLTLAVPREFGGLGARWPDIYETIRKIAQVDSALAHLLGFTCLQVVSV
FT                   NVWGNPEQRARYLSGTVEGRWWWGNAVNPLDTRLVASATDDGGYLLDGQKGFCSGTRGS
FT                   QMMTVSAHDPLTGKPVFGVVPTTREGITVHDDWNPIGQRQTDSGSVSFTRVKVEPNEVM
FT                   VRPDTPHASLRTLISQQVLTNLFVGIAQGALDEARAYVTQNGKAWIYSGVDKATDDPYL
FT                   IQRFGEMRLQAVSAEALATRAAWLLEDAWQQGPALTAETRAQVALATSEAKIVAHRAAL
FT                   DVSEKLFDACGARATHAPLALDRFWRNARVHTLHDPLDYRVRDVGRYALTGALPEVSLY
FT                   T"
     atgaacgatc ctcgtcatgc cgacgcgttg caaacgcctc aggcattcgc tgagtctgag        60
     gtgcgcgatc tcgcgggttt gctcgacgcg ctgcgcgcca gtgccgcgca gcgcgatatc       120
     gatggcggcc acgccgcgcg ggaaaaacaa tggatcgccg acgcggggct gcttacgctc       180
     gcggtgccac gcgaattcgg cggcctcggc gcgcgctggc ccgacatcta cgagacgatc       240
     cgcaagatcg cgcaagtgga cagtgcgctc gcgcatttgc tgggcttcac ctgtctgcag       300
     gtggtcagcg tcaatgtatg gggcaatccg gaacaacgtg cccgctatct gagcggcacc       360
     gtcgaaggac gatggtggtg gggcaacgcc gtcaatccac tcgacacccg gctcgttgca       420
     agcgcaaccg atgacggcgg ctatctgctc gacggccaga agggcttctg ctccggcaca       480
     cgcggctcgc agatgatgac ggtctccgca cacgatccgc tcaccggcaa accggtcttc       540
     ggcgtcgtgc cgacgacgcg tgaaggcatc accgttcacg acgactggaa cccgatcggc       600
     cagcggcaga ccgatagcgg cagcgtgtcc ttcacacggg tcaaggtcga acccaatgaa       660
     gtgatggtgc ggcccgacac gccgcatgca agtctgcgca cgctgatctc gcaacaggtg       720
     ctgaccaatc tgttcgtagg cattgcccaa ggcgcgctcg acgaagcgcg cgcctacgtc       780
     acgcagaacg gcaaggcgtg gatctattcc ggcgtcgaca aggccaccga cgatccctac       840
     ctgatccagc gtttcggcga aatgcgcttg caggcggtga gcgccgaagc gctggcgacg       900
     cgtgcggcct ggctgctgga agatgcgtgg caacaagggc cggcgcttac cgcggaaacc       960
     cgcgcgcagg ttgcgctcgc cacgtcggag gcgaagatcg tcgcgcatcg cgccgcgctc      1020
     gacgtcagcg aaaaattgtt cgacgcctgt ggcgcccgcg cgacgcacgc gccgctcgcg      1080
     ctcgaccgtt tctggcgcaa tgcccgcgtg cacacgctgc atgatccgct cgactatcgt      1140
     gtgcgcgacg tcggccgata cgcgctcacc ggcgcgttgc cggaagtttc tttgtacact      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page