(data stored in ACNUC7421 zone)

EMBL: CP001053.PE54

CP001053.PE54        Location/Qualifiers
FT   CDS_pept        59188..60105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4045"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: bxe:Bxe_B0499
FT                   putative diguanylate phosphodiesterase (EAL domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4045"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18429"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA8"
FT                   /protein_id="ACD18429.1"
FT                   /translation="MCIRWRGLNIMSAMYTLDYAQPKSLANALDSRVDFVAQNDAETSG
FT                   DASLRLSELERRVCDGLHAGEFHLVFQGAYRAASGVLARLEAQVRWMHPDYGLLLPGIF
FT                   MMPLDHPIVAREMVSFVVDSVCRELRDALRAKLPLQPIAITVPAQVALLDSFAEELVRV
FT                   AGSYGVPASLLEIEVTDSVEAAKLLSLRTLTEGLRAAGIGLSIGKWGNGASSLASLGSL
FT                   DVDTVVVARELMPAVPGDKRGAAVMTAIMDLLHALDLRVVVSGVDTQEQFRWLCRWPEA
FT                   LVQGVLFGRPKVGLARVLELRWEA"
     atgtgcatac gttggcgggg tttgaatatc atgtccgcca tgtacacgct cgactatgca        60
     caacccaaat cgcttgcaaa cgcgttggac tcacgcgtcg actttgttgc gcagaatgac       120
     gcggagactt ccggcgatgc ttccttgcgc ctgagcgaac tcgaacgccg tgtttgcgat       180
     ggactgcatg cgggcgaatt ccatcttgtg tttcaaggcg cgtatcgcgc cgcgagtggc       240
     gtattggcgc gccttgaagc gcaagttcga tggatgcatc cggattacgg cttgctgttg       300
     ccgggcattt ttatgatgcc gctcgaccat ccgatagttg cgcgcgagat ggtttcattc       360
     gtcgtggaca gcgtttgccg tgaattgcgc gacgctctcc gcgcgaagtt gccgttgcag       420
     cccattgcga ttacggtgcc cgctcaagtg gcgttgctcg attcgttcgc agaagaactt       480
     gtgcgagtgg ccggttcgta tggcgtgccg gcgtctctgc ttgaaattga agttaccgat       540
     agcgtagaag cagcaaagct attgtctttg cgtacgttga ccgagggtct tcgcgcagca       600
     ggtattggtc tttcgatagg caagtggggt aatggcgcgt cgtcgctggc ctcgctcggg       660
     tcgctcgatg tcgacaccgt cgttgtcgcg cgcgagttga tgccggcagt tccgggcgac       720
     aagcgtggcg ccgcggtgat gaccgcgatc atggacctgc tgcacgcgct cgatctgcga       780
     gtggtggtga gcggcgtcga tacacaagaa cagtttcggt ggctgtgccg atggccggaa       840
     gcgctcgtgc agggggtgtt gttcgggcgt ccgaaggtgg ggttggcgcg ggtgttggag       900
     ctaaggtggg aggcgtga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page