(data stored in ACNUC7421 zone)

EMBL: CP001053.PE551

CP001053.PE551       Location/Qualifiers
FT   CDS_pept        629030..629437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4553"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bxe:Bxe_B0866 putative
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4553"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18926"
FT                   /db_xref="GOA:B2TDX2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDX2"
FT                   /protein_id="ACD18926.1"
FT                   /translation="MTFSIDTLDHLVLNVADVEVSAAWYARMLGMRRAEFESRTGTRVA
FT                   MFYGNQKINLRPVTADTVAWFTGREPVPGSADLCFVTTTSPAEVKAHWLAQGVEIEAGP
FT                   VERDGARGKMTSVYCRDPDGNLIEVATYPQV"
     atgacctttt cgatagacac gctcgatcat ctcgttctga acgtcgccga cgtggaagtc        60
     agcgcggcgt ggtacgcacg tatgctcggc atgcggcgcg ccgagttcga gtcgcgcacc       120
     ggcacgcggg tggcgatgtt ctacggcaat cagaagatca atctgcgtcc cgtaaccgcc       180
     gacaccgtcg cgtggttcac cggccgcgag ccggtgcctg gcagcgccga tctgtgcttc       240
     gtcacgacca cgagcccggc cgaggtcaag gcacattggc tggcgcaagg cgtcgaaatc       300
     gaggccggtc cggtggagcg cgacggcgcg cgcggcaaga tgacctcggt gtattgccgc       360
     gatcctgacg gcaatctgat cgaagtcgca acgtatcctc aagtataa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page