(data stored in ACNUC7421 zone)

EMBL: CP001053.PE555

CP001053.PE555       Location/Qualifiers
FT   CDS_pept        complement(632171..633472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4557"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bxe:Bxe_B0871 major
FT                   facilitator superfamily (MFS)metabolite/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4557"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18930"
FT                   /db_xref="GOA:B2TD16"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD16"
FT                   /protein_id="ACD18930.1"
FT                   /translation="MQATNLGGAQAVTPRPLGRSDYKTLGLAALGGALEFYDFIIFVFF
FT                   APAIGQLFFPAAMPDWLRQVQTFGIFAAGYLARPLGGIIMAHFGDLFGRKRMFTLSVLL
FT                   MSVPTLMMGLLPTYTSIGVLAPVLLLLFRVMQGAAVGGEVPGAWVFVSEHVPQRHIGYA
FT                   CGTLTAGLTAGILLGSLIASAVNRNFAPAEISAYAWRIPFLVGGVFGMFSVYLRRWLHE
FT                   TPVFAELKQRKAIAAEVPLKAVLRDHGRAVIVSMLLTWMLSAAIVVVILMTPTLLQKQF
FT                   HIAPATALLANCVATLCLTIGCVMAGSIAGRIGAGRTIFIGGVALAVTYYVMFQQLAVD
FT                   TSALVPLYAVAGLFVGVIGAIPFVMVKAFPPVVRFSGISFSYNVAYAVFGGLTPIAVSL
FT                   MMKSNPMAAPMYVGAICILGALTTLFIKDAPQKH"
     atgcaagcga caaatctggg tggagcgcag gctgtcaccc cacgccctct tgggcgcagc        60
     gattacaaaa cgctcggact cgccgccctc ggcggggcgc tggagtttta cgacttcatc       120
     atcttcgtat ttttcgcgcc ggcgatcggc cagctattct ttccggccgc aatgcccgac       180
     tggctgcgtc aggtgcagac cttcggcatc ttcgcggcgg gctatctggc gcggccgctg       240
     ggcggcatca tcatggcgca tttcggcgac ctgttcggcc gcaagcgcat gttcacgctg       300
     agcgtgctgc tcatgtcggt gcccacgctg atgatgggcc tgctgcccac ttacaccagc       360
     atcggcgtgc tggcgccggt cctgttgctg ctgtttcgtg tgatgcaagg cgcggcggtc       420
     ggcggtgaag ttccgggcgc gtgggtgttc gtctcggagc acgtgccgca gcggcacatc       480
     ggctatgcat gcggcacgct gacggccggc ctcacggcag gcattctgct cggctcgctg       540
     atcgcctcgg cggtgaaccg caacttcgcg ccggcggaaa tctccgccta cgcgtggcgc       600
     attccgttcc tggtgggtgg cgtgttcggc atgttttcgg tgtatctgcg ccgctggctg       660
     catgaaacgc cggtgttcgc cgaactcaag cagcgcaagg cgatcgccgc cgaagtgccg       720
     ctcaaggccg tgctgcgcga ccacggccgc gccgtgatcg tctcgatgct gctcacgtgg       780
     atgctctccg ccgcgatcgt cgtggtgatc ctgatgacgc cgacgctgct gcaaaagcaa       840
     ttccacatcg cgccggccac ggcgctgctg gcgaactgcg tggcgacgct gtgcctgacg       900
     atcggctgtg tgatggcggg ttcgattgcc ggccgcatcg gcgcggggcg cacgattttc       960
     atcggcggcg tggcgctggc ggtgacgtac tacgtgatgt tccagcaact cgccgtcgac      1020
     acctccgcgc tcgtgccgct gtatgcggtg gcgggtctgt tcgtcggagt gatcggcgcg      1080
     attccgttcg tgatggtcaa ggcgttcccg cccgtggtgc gtttttcggg catctcgttc      1140
     tcgtacaacg tggcatacgc cgtgttcggc ggcctcacgc cgatcgccgt gtcgctgatg      1200
     atgaagtcga acccgatggc cgcgccgatg tatgtcggcg cgatctgcat tctcggggca      1260
     ttgaccacgc tgttcatcaa ggacgcgccg cagaagcact ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page