(data stored in ACNUC7421 zone)

EMBL: CP001053.PE556

CP001053.PE556       Location/Qualifiers
FT   CDS_pept        633871..634611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4558"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bxe:Bxe_B0872 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4558"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18931"
FT                   /db_xref="GOA:B2TD17"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD17"
FT                   /protein_id="ACD18931.1"
FT                   /translation="MRIAILQRDLVMRQSIEKVLTSAGHSCSTYDDGLSMSRALARSTV
FT                   DLLVLDWQGLRLSGAEVLRAARAVGGDRLPVMFASADTAEENIVRAFVAGADDYVALPL
FT                   RAAEFRERVAALLRRAYPDRFSSASFDVGPYHFDTHRQLVMLRGQPVQLSGTQYRLASL
FT                   FFSNIGRVLSRDHIFAMVWGREFREFTRTIDSHVSRLRLLLEIEPQNEFRLQPVYKSGY
FT                   RLLHLRQGEAAVINAQIDAEKQAA"
     atgcgtattg ccattcttca gcgtgacctg gtcatgcgtc agtcgatcga aaaggtcctg        60
     acgagcgctg gccattcctg ctcgacctat gacgacggcc tgagcatgtc gagagcgctc       120
     gcgcgttcca cggtcgatct gctggtgctc gactggcagg gcctgcgcct ctccggcgcc       180
     gaggtgttgc gcgcggcgcg cgcggtgggc ggcgaccgtc tgccggtcat gttcgcatcg       240
     gcggacacgg ccgaggaaaa catcgtgcgc gcgttcgttg ccggcgcgga cgactatgtc       300
     gcgttgccgc tgcgcgcagc cgagtttcgc gagcgggtcg cggcactgct gcggcgggcc       360
     tatccagacc ggttcagctc cgccagtttc gatgtcggcc cctaccattt cgacacgcac       420
     cgtcaactcg tcatgctgcg cggccagccg gttcagctat ccggcacgca gtaccggctg       480
     gcgtcgctgt tcttctccaa catcggccgc gtgctgtcgc gcgaccatat cttcgcgatg       540
     gtgtggggtc gcgagttccg cgaattcacc cgcaccatcg acagccacgt ttcgcggctg       600
     cgcctcctgc tcgagatcga gccgcaaaac gaattccggc tgcaaccggt ttataaaagc       660
     ggctaccggc tgctgcatct gcgtcagggt gaagccgccg ttatcaatgc gcagatcgac       720
     gccgagaagc aggcggcctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page