(data stored in ACNUC7421 zone)

EMBL: CP001053.PE56

CP001053.PE56        Location/Qualifiers
FT   CDS_pept        complement(61098..62264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4047"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18431"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB0"
FT                   /protein_id="ACD18431.1"
FT                   /translation="MTIHLDAGPLADALVMQCRSTGYAGYDPFDGLNSVLFEKLGLGCL
FT                   PFAKIAWLQLHKRSLANLRPLVGVARRRNPKGIALIILGLLERERRVGDGWSIEEAVGL
FT                   ADWLLDQRCDRKKWTHSAWGYHFDWAARAFFVPRGTPNAITTCYIARALTALGDETGER
FT                   RFTDAATDAGFFIDSLYREGDGYYAYIPGESAFVHNANLWAAAVVGETASRVGNGALMQ
FT                   RALGAARRSVAMQREDGAWRYGTRDHHSFVDGFHTGYNLEALSALQRSAGTDEFSDAIG
FT                   RGMAYYRQNFFLPDGTVKYYDNAIWPLDTHSVAQALLTLLNVGASDEDHRLADRVFKRA
FT                   LNTLYMPRERRFMYQRGRLTKNRINYLRWTQAWAFYAIGAYANSARFK"
     atgactatcc atctcgacgc cggcccgctc gccgacgcgc tggttatgca atgccgttca        60
     accggctacg ccggctacga cccttttgac ggcctcaata gcgtattgtt cgagaagcta       120
     ggacttggct gtctgccgtt cgcaaagatt gcgtggctac agcttcacaa acgcagcctc       180
     gcaaacttgc gcccacttgt cggcgttgcg cgccgccgca accccaaagg catcgcattg       240
     atcatccttg gacttcttga acgtgaacga agggtgggcg acggatggtc aattgaagaa       300
     gctgttgggc tcgcggattg gctgctggac cagcgttgcg atcggaagaa atggacgcac       360
     agcgcctggg gttaccactt tgactgggcc gcgcgcgctt tcttcgtgcc tcgcggcacg       420
     cccaatgcaa tcacgacatg ttacatagcc cgggcactga ccgcactcgg agatgagacc       480
     ggtgagcggc gatttacaga tgcggcgaca gacgccggat tctttatcga ttcactctac       540
     cgggaggggg atggctatta cgcatacatc cccggtgaat ccgccttcgt acacaacgca       600
     aacttgtggg cggctgcggt tgtcggcgaa accgcgagtc gcgtgggtaa tggtgcgctg       660
     atgcagcgcg cgctcggcgc tgcccgccgc tcagtagcaa tgcaacgtga ggacggcgcg       720
     tggcgctacg gcactcgcga ccatcactct ttcgtggatg gctttcacac cggctacaac       780
     ctcgaagcac tgtcggcact acaacgatcg gccggaactg atgagtttag cgacgccatc       840
     ggtcgcggaa tggcctacta ccgacagaat ttctttttgc cagatggcac tgttaaatac       900
     tacgacaacg ctatctggcc gctcgatacg cattcggtag ctcaggcatt gcttacgctg       960
     ctgaacgttg gcgcgtccga tgaagatcac aggttggcgg atcgagtttt caagcgagcg      1020
     ctcaacacgc tctacatgcc gcgtgagcgc cgtttcatgt accagagagg aagactgaca      1080
     aagaatcgaa tcaactattt acgatggacg caggcgtggg ccttctacgc catcggcgcc      1140
     tacgcaaaca gcgcccgatt caagtga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page