(data stored in ACNUC7421 zone)

EMBL: CP001053.PE563

CP001053.PE563       Location/Qualifiers
FT   CDS_pept        complement(641360..641620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4565"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18938"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD24"
FT                   /protein_id="ACD18938.1"
FT                   /translation="MNQPDHNTNDTPAPAKRPTILRRLLSHHELATLLLLLHAPIDAFA
FT                   KPEIPQLHEAGLVETVSSDAGGSRIRLTPEGNAVLRGLGIK"
     atgaaccagc ccgatcacaa cacgaacgac accccggcgc cggccaagcg gcctaccatt        60
     ttgcgccgcc tgctgagcca ccacgagttg gcgacgctgc tgctgttgct gcacgcgccg       120
     atcgacgcat ttgccaaacc cgagattccg cagcttcacg aagccggatt ggttgaaacc       180
     gtgtccagcg acgcaggcgg ttcgcgtatc cgtctgacgc ccgagggcaa cgccgtactg       240
     cgcggcctcg gcataaagta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page