(data stored in ACNUC7421 zone)

EMBL: CP001053.PE564

CP001053.PE564       Location/Qualifiers
FT   CDS_pept        complement(641778..642110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4566"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4566"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18939"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD25"
FT                   /protein_id="ACD18939.1"
FT                   /translation="MKKFAVVLSIPLLLSACAYFQKNPDAGEPVTDTTTQRSVNDVVSC
FT                   LTQLATSHDAAFKSTAIPQGQMLDFGDSNIVKVRSDNGATTYRFYAGKRHVSNLWIESA
FT                   GKTCAP"
     atgaagaagt ttgccgtagt cctgtcaatt cccctgctcc tcagcgcttg cgcgtacttc        60
     cagaagaatc cggatgccgg cgagcccgtt acggacacca ccacgcaacg ctccgtcaac       120
     gacgtggtct cgtgcctcac gcaattggcc accagccacg acgccgcgtt caaatccacg       180
     gcgatcccgc aaggccagat gctcgacttc ggcgattcga atatcgtcaa ggtgcgcagc       240
     gacaacggcg cgacgactta ccgtttctac gcgggcaagc gccacgtgag caatctgtgg       300
     atcgagtccg cgggcaaaac ctgcgccccg taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page