(data stored in ACNUC7421 zone)

EMBL: CP001053.PE565

CP001053.PE565       Location/Qualifiers
FT   CDS_pept        complement(642301..644184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4567"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; Xylose isomerase domain protein TIM
FT                   barrel; KEGG: bxe:Bxe_B0882 4-hydroxyphenylpyruvate
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4567"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18940"
FT                   /db_xref="GOA:B2TD26"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD26"
FT                   /protein_id="ACD18940.1"
FT                   /translation="MQRSIATVSISGTLVEKLTAIQAAGFEGVEIFENDLLYFDGSPAD
FT                   VRRIAEDLGLKIMLFQPFRDFDGVSPERLERNLDRAKRKFDVMHELGTDRILVCSNVSP
FT                   DTIGDDALMTDQLGALARAAEAAGVIAGYEALAWGKHVKTYRHAWKLVNTVNHPNLGLV
FT                   LDSFHTLSLNDTPDAIADIPGGRIAFVQIADAPKLAMDVLEWSRHYRCFPGQGDFDLAN
FT                   FTAQVVKTGYSGPLSLEIFNDGFRAAPTTITAADGHRSLLFLEEQTRALLESTQQPVGD
FT                   LYRSPAAPAHVGYQFLEFAVDHSTRAQLVDWLGKLRFREAGRHRSKEVTLYQHGAASIV
FT                   LNAEPDSFANAFFQQHGLSLCASAFRVDDANQAFERAAGFGYAPFSGQIGPNERVLPAV
FT                   QAPDSSLNYFVDETPDQPTLFEADFVLTDINGPSEVGPLSRIDHVCLSVPANSLDTWVL
FT                   FLRTALGFQAEPGVLVPDPYGLVRSRALRSHDGSVRIVLNASVDHHTAVAEALHTYHGS
FT                   GLNHVAFSTSDIFSAIPEFVADGLPVLRIPRNYYEDLAARYALPDGTLEALRANNILYD
FT                   RDERGGEFFHAYTEQLDQRFFMEIVERRGGYDGYGAANAAVRLAAQAQRRK"
     atgcaacgtt cgattgccac cgtgtcgatc agcggaaccc tcgtcgagaa gctgaccgcg        60
     atccaggcgg cgggcttcga aggcgtcgag attttcgaaa acgatttgct gtatttcgac       120
     ggctcgcccg ccgacgtgcg gcgcatcgct gaagatctcg ggctgaaaat catgctgttt       180
     cagcctttcc gcgatttcga cggtgtcagc ccggagcgtc tcgagcgcaa tctcgaccgc       240
     gcgaagcgca agttcgacgt catgcatgaa ctgggcacgg accgcattct ggtgtgcagc       300
     aacgtttcgc ccgacaccat cggcgacgac gcattgatga ccgaccagct cggcgcgctg       360
     gcgcgcgcgg cggaggcggc cggcgtgatc gcgggctatg aagcgctcgc gtggggcaag       420
     cacgtcaaga cctaccggca cgcgtggaag ctcgtgaata cggtgaatca cccgaatctc       480
     gggctcgtgc tcgacagctt ccacacgctg tcgctgaacg acacgccgga cgcgatcgcc       540
     gacattccgg gcggccgcat cgccttcgtg cagatcgccg acgcgccgaa gctcgccatg       600
     gacgtgctcg aatggagccg ccattaccgc tgcttccccg gccagggcga tttcgatctg       660
     gccaatttca cggcgcaggt cgtgaaaacc ggctacagcg ggccgctttc gctggaaatt       720
     ttcaacgacg gttttcgcgc cgcgccgacc accatcacgg ccgccgatgg tcatcgctcg       780
     ctcctgtttc tcgaggagca gacccgcgcg ctgctcgaaa gcacgcagca gccggtcggc       840
     gacctgtatc gctcgcctgc ggcgcccgcg cacgtcggct accagtttct ggagttcgcg       900
     gtcgaccaca gcacgcgggc gcaactcgtc gactggctcg gcaaactgcg ctttcgcgag       960
     gcgggccggc atcgctcgaa ggaagtcacg ctgtatcagc acggcgcggc ctcgatcgtg      1020
     ctgaacgccg agccggattc gttcgctaac gcgttcttcc agcagcatgg cttgtcgctg      1080
     tgcgcgtcgg cgtttcgcgt ggacgatgcc aatcaggcgt tcgaacgcgc cgccggcttc      1140
     ggctacgcgc cgttttccgg gcagatcggc ccgaacgagc gcgtgctgcc cgccgtgcag      1200
     gcaccggaca gcagcctgaa ctatttcgtc gacgaaacgc cggatcagcc caccttgttc      1260
     gaggccgatt tcgtcctcac cgacatcaac ggcccgagcg aagtggggcc gctcagccgc      1320
     atcgaccatg tgtgcctgtc ggtgccggcg aattcgctgg atacttgggt gctgtttctg      1380
     cgcacggctt taggcttcca ggccgagcct ggcgtgctgg tgcccgatcc gtacggcctc      1440
     gtgcgcagcc gcgcgctgcg cagtcacgac ggttcggtgc ggatcgtgct gaatgcctcc      1500
     gtggaccatc acacggcggt ggccgaggcg ttgcatacgt atcatggctc gggcctgaac      1560
     cacgtcgcct tcagcaccag tgacattttt agcgcgattc ccgagttcgt cgccgacggc      1620
     ttgccggtcc tgcgcatccc gcgcaattac tacgaggatc tggccgcccg ctacgcgttg      1680
     ccggacggga cgctggaggc gctgcgcgcc aataacatcc tgtacgaccg cgacgagcgc      1740
     ggcggcgagt ttttccatgc ttacacggag cagctcgacc agcgcttttt tatggagatc      1800
     gtcgagcggc gcggcggtta tgacggttat ggcgcggcta atgctgccgt gcggctcgcc      1860
     gcgcaggcgc agcggcgcaa gtag                                             1884
//

If you have problems or comments...

PBIL Back to PBIL home page