(data stored in ACNUC7421 zone)

EMBL: CP001053.PE571

CP001053.PE571       Location/Qualifiers
FT   CDS_pept        complement(649568..650350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4573"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18946"
FT                   /db_xref="GOA:B2TD32"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD32"
FT                   /protein_id="ACD18946.1"
FT                   /translation="MNLHRYPQLVDLLAAEYVLGTLRGGARRRFERYADHDTTIRKAVE
FT                   QWQRRISPMAELAEPRMPPAAVWDAIERRLGLTATREAARPRTVVETPARPSRSIFENL
FT                   AFWRGWALGVTGLAAVAVVVAVRSLLPSATPPVTAPTVAQQPETAVSHVAVLNNKDAHP
FT                   VMLVAWDEAHSTMSVHPLGKVELPAGRAMELWGIPASGHPVSLGMLPDSANGKVTAGQQ
FT                   KPENYAALAVSIEAPGGSPDHNAPSGPVVFTGKLLPVS"
     atgaatctgc atcgctatcc tcagctcgtc gatctgctgg ccgccgaata cgtgctcggc        60
     acattgcgcg gcggtgcgcg gcggcgcttc gaacgctacg cggaccatga cacgacgatc       120
     cgcaaagccg tcgagcaatg gcagcggcgc atctcgccga tggccgaact cgccgagccg       180
     cgcatgccgc cggccgccgt ctgggacgcc atcgaacggc gactcggcct cacggccacg       240
     cgcgaggcag cgcgtcctcg caccgtggtg gaaacacccg cgcggccatc gcgcagcatc       300
     ttcgaaaacc tggcgttctg gcgcggctgg gcgctcggcg tcacgggcct cgcagcggtt       360
     gccgtggtgg tcgccgtgcg ctcgctgttg ccgtccgcca cgccgcctgt cacggcgccg       420
     accgttgctc agcaacccga aacggccgtg tcgcatgtcg ccgtgctgaa caacaaggac       480
     gcgcatccgg tcatgctggt cgcgtgggac gaggcgcatt cgaccatgtc ggtgcatccg       540
     ctcggcaagg tcgagctgcc cgccggccgg gcgatggaac tgtggggcat tccggcgagc       600
     ggccatccgg tctcgctcgg catgctgccg gacagcgcga acggcaaggt cacggccggc       660
     cagcagaagc cggagaatta cgcggcgctg gccgtgtcga tcgaagcgcc gggcggctcg       720
     cccgatcaca acgcgccgag cggtccggtg gtgttcaccg gcaagctgtt gccggtgtcg       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page