(data stored in ACNUC7421 zone)

EMBL: CP001053.PE574

CP001053.PE574       Location/Qualifiers
FT   CDS_pept        652473..653456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4576"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: reh:H16_B0214 transcriptional
FT                   regulator, LysR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4576"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18949"
FT                   /db_xref="GOA:B2TD35"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD35"
FT                   /protein_id="ACD18949.1"
FT                   /translation="MKDTLNVLLSKLRMKQLQLLIALDDLKSLHKAAGAMSMTQSAASK
FT                   ALQELESMLEAPLFERSKSGMIPNQLGHCVIRYARLMTTDLTALCQDVAEIRSGRGGRL
FT                   AIGAIMGAIPECVVPALNQLHAAQPGLSVEVVEDTSARMLRQLDDGRLDLVIGRATVAA
FT                   DPSKYHYRPLGDEPLSVVVGYGHPPLPKKEVKLRDLAGHRWVMYPSHMPLHALLEREMD
FT                   LAGLQMPDNPVSTASTFVTVALLQSSHDLVSLLPTAIAALFVRQKMLRLVPVKLKSPSQ
FT                   TFGIVTRKGGVLSPPAEQFIELLCAQPIEPAQGRLPEHPARKQKTA"
     atgaaagaca ccctcaacgt cctgctgtcg aagctgcgca tgaagcaact ccaattgctg        60
     atcgccctcg acgacctgaa gtcgctgcac aaagccgccg gcgccatgtc catgacgcag       120
     tcggccgcca gcaaggcctt gcaggaactg gagtcgatgc tcgaggcacc cctcttcgag       180
     cgctcgaaaa gcggcatgat cccgaaccag ctcggccatt gcgtgatccg ctacgcgcgc       240
     ctcatgacga ccgatctcac cgcgctctgc caggacgtcg ccgagatacg ttccgggcgt       300
     ggcgggcggc tcgcgatcgg cgcgatcatg ggcgcgattc cggagtgcgt cgtgccggcg       360
     ctgaatcagc tgcatgccgc gcaaccgggt ctttccgtcg aagtggtgga agacacgagc       420
     gcgcgcatgc tgcggcaact cgacgacggc cggctcgatc tggtgatcgg ccgcgcgacg       480
     gtggcggccg atccgtcgaa atatcactat cgtccgctcg gcgatgaacc gctctcggtg       540
     gtggtcggct acggccatcc gccgttgccg aagaaagagg tgaaactgcg cgatctggcg       600
     ggccaccgct gggtcatgta tccatcgcat atgccgctgc acgcgctgct cgaacgcgag       660
     atggatctgg ccggtctgca aatgccggat aacccggttt ccacggcctc gacgttcgtg       720
     acggtggcgc tcctgcaaag cagtcacgat ctggtttcgc tgttgcccac ggcgatcgcc       780
     gccttattcg tccggcaaaa aatgctgcgc ctcgtgccgg tcaagctcaa gtcgccttcg       840
     cagacttttg gcatcgtcac gcgcaaaggc ggcgtgttgt cgccgccggc ggaacagttc       900
     atcgaattgc tgtgcgcgca gccgatcgaa ccggcgcaag ggcggttgcc ggaacacccg       960
     gcgagaaagc aaaaaaccgc ctga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page