(data stored in ACNUC7421 zone)

EMBL: CP001053.PE575

CP001053.PE575       Location/Qualifiers
FT   CDS_pept        653652..656732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4577"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18950"
FT                   /db_xref="GOA:B2TD36"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD36"
FT                   /protein_id="ACD18950.1"
FT                   /translation="MNRPLVRLPFRATGVASVRKWFKWALVAAFLLALALAARFCQNEI
FT                   ETSRLQAHYLSELTRDVGFSVADGPSHSIRFPEADKGPYDSRLGYALLPSIQQRLLQRG
FT                   FEITAQARDSERMLSLADNGLFLPYEEKDRAGLQLFDGTGAPLFAAQFPGRVYDDFDAI
FT                   PPLVVNSLLFIEDRYLLDPNQPNRNPAIDWGRFSRALADQGVRVFNHHQSQPGGSTLAT
FT                   QIEKFRHSAGGRTATPPEKLRQIASASVRAYLNGPQTMPARQQIVVHYLNSVPLAAQPG
FT                   IGEINGIGDGLAAWYGRDFNDVNRVLIAPSTEQNLPEQGIAFRQVLSLMIAQRAPSYFL
FT                   HHGYKELERLTDSYLRLLANGGIVSVPLRDAALSAVVDLQRAPVKTASADSFVSRKAVT
FT                   SMRSHLLAALNIPSFYELDRLDLQANGTLNNAVQQAVSDRLAAAATRDGAKAAGLVGFE
FT                   MLRASDDPSRIAYSFTLFERRDGANLVRVQTDSVNQPFDINSGARLNLGSTAKLRTVVT
FT                   YLQIVSDLHKRYAPLSTAELKAVKYDPNDQLTRWSLDYFAHTSDRSLQAMLDAAVERKY
FT                   SASPGETFYTGGGAQTFNNFESDDNSRILTVHRAFQHSVNLVFVRLMRDIVHYEMVQTT
FT                   GPSAQWLGDPEMRKMYLTRFADQESRVYMNRFYTKYHGKTPDQALSLLLLGVRKSPPKV
FT                   ATVLRSVAPDESNAWFNLKMRAALKNTPAASVLDDEDLANLYAKYAIDRFNLNDRGYIS
FT                   SVHPLELWTLNYLREHPDATLEQIQSASREVRLSTYSWLFKTRYHATQDRRIKRMVELR
FT                   AYDAIGKSWQALGYPFATLTPSYAAAIGASGDRPAALAQLIGVVANNGNKVPTESLTQL
FT                   DFAKDTPYETHFKRAAVAPEPQLSPEIASTVKVLLRDVVTGGTAKRLAQGMTFPDGQTL
FT                   EVYGKTGTGDQRFNVFAKGARLIESRKVNRSATFVFAMGDRFYGTLTAWVHEPYAAHYE
FT                   FTSALSVQLLKSLAPVLQPLLNETPVKTASVTKVAAQ"
     atgaatcggc cgctggttcg gttaccgttt cgcgcaacag gcgtggcgtc tgtgcgcaaa        60
     tggttcaaat gggcgctggt cgcggcattt ttgctcgcgc tggcattggc ggcacgcttt       120
     tgccagaacg agatcgaaac ctcgcgattg caggcgcact atctctccga attgactcgc       180
     gacgtgggtt tctccgtcgc cgacggtcct agtcattcca tccgttttcc cgaagccgac       240
     aaaggccctt acgacagccg tctgggctac gcgttgctac cgtcgatcca gcagcgtctg       300
     ctgcaacgcg gctttgaaat caccgcccag gcgcgcgatt ccgagcggat gctgtcgctg       360
     gcggataacg gcctctttct gccgtacgaa gaaaaagatc gcgcgggcct gcaactcttc       420
     gacggcaccg gcgcgccgct gttcgccgcg cagtttcccg gccgcgtgta cgacgacttc       480
     gatgcgattc cgccgctggt cgtgaattcg ctgctgttta tcgaagaccg ctacctgctc       540
     gatccgaacc agccgaaccg caatcccgcc atcgactggg ggcgctttag ccgcgcgttg       600
     gccgatcagg gcgtgcgcgt gttcaatcac catcagtcgc agcccggcgg tagcactctc       660
     gccacgcaga tcgaaaaatt ccgccactcc gcgggcggcc gcacggcgac accgccggag       720
     aaattgcggc agatcgcctc ggcttcggtg cgcgcttatc tgaatggccc gcaaaccatg       780
     ccggcgcgcc agcagatcgt ggtccactat ctcaactcgg tgccgctggc cgcgcagccg       840
     ggcatcggcg aaatcaacgg tattggcgac ggtctcgccg cctggtatgg ccgcgacttc       900
     aacgacgtca accgcgtcct gatcgctccg tcgaccgaac agaatctgcc ggagcagggc       960
     atcgcattcc ggcaggtgct ttcgttgatg atcgcgcaac gtgcgccgtc gtatttcctg      1020
     catcacggct acaaggaact tgagcggctg acggacagtt atctgcggct gctggcgaac      1080
     ggcggcattg tgtcggtccc gttgcgcgac gccgcgctct cagcggtggt cgatttgcag      1140
     cgcgcgcccg tcaaaactgc cagtgcggat tccttcgtgt cgcgcaaggc ggtgacgtcc      1200
     atgcgctcgc atcttctggc cgcgctcaac attccgagct tctacgaact cgaccgcctc      1260
     gatctacagg cgaatggcac gctcaacaac gccgttcagc aagccgtgag cgaccggctc      1320
     gccgctgccg ccacgcgcga cggcgcgaaa gccgcgggtc tggtcggctt cgaaatgctg      1380
     cgcgcgtcgg acgatccttc gaggatcgcg tatagcttca cgctgttcga gcggcgcgac      1440
     ggcgccaacc tcgtgcgggt gcaaaccgac agcgtcaacc agccgttcga catcaactcc      1500
     ggcgcgcgcc tgaatctcgg ttcgacggcg aaactgcgta ccgtggtgac gtatttgcag      1560
     atcgtctccg acttgcacaa gcgttatgcg ccgctgagca cagcggagct gaaagccgtg      1620
     aagtacgatc cgaacgatca actcacgcgc tggtcgctcg attatttcgc gcacacctcg      1680
     gaccgttcgc tgcaagccat gctcgacgcg gccgtggagc gaaaatactc ggccagtccc      1740
     ggcgaaactt tctacacggg cggcggcgcg cagaccttca acaacttcga atccgacgac      1800
     aacagccgca tcctgaccgt gcaccgcgcg ttccagcatt cggtgaatct ggtgttcgtg      1860
     cggctgatgc gcgacatcgt ccattacgaa atggtgcaga ccaccgggcc gtcggcgcaa      1920
     tggctgggcg atcccgagat gcgcaagatg tatctgacgc gcttcgccga tcaggaaagc      1980
     cgcgtgtaca tgaaccgttt ctacacgaag tatcacggca agacacccga tcaggccttg      2040
     tcgctgctgc tgctcggcgt gcgcaaatcg ccgcccaagg tggcgacggt gttgcgcagc      2100
     gtcgcgccgg acgagtccaa tgcgtggttc aacctcaaga tgcgcgcggc gctgaaaaac      2160
     acgcccgccg cctccgtact cgacgacgaa gacctggcta acctgtacgc caaatacgcg      2220
     atcgaccgct tcaatctgaa cgatcgcggc tatatttcga gcgtgcatcc gctggaactg      2280
     tggacgctca actatctgcg cgagcatccc gatgcgacgc tcgaacagat ccagagcgcg      2340
     agccgcgagg tacgtctgtc gacttattcg tggctcttca agacgcgcta tcacgcgacg      2400
     caagaccgcc gcatcaaacg catggtcgaa ctgcgtgcct acgacgccat cggcaaatca      2460
     tggcaggcgc tcggctatcc gttcgcgacg ctcacacctt cgtatgccgc ggcaatcggc      2520
     gcgtcgggcg accggccggc cgcgctcgcg caattgatcg gcgtggtcgc caataacggc      2580
     aacaaggtgc cgacggaaag cctcacgcaa ctcgacttcg cgaaagacac tccgtacgaa      2640
     acgcatttca aacgcgcggc ggtggcgccc gagccgcagt tgtcgccgga aatcgcgagc      2700
     acggtgaaag tgttgttgcg cgatgtcgtg accggcggca cggcgaagcg tctcgcgcaa      2760
     ggcatgacgt tccccgatgg ccagacgctc gaggtgtacg gcaagaccgg taccggcgat      2820
     cagcgcttca atgtgtttgc caaaggcgcg cggctgatcg agtcgcgcaa ggtgaaccgt      2880
     agcgcgacct ttgtgttcgc gatgggcgac cggttctacg gcaccttgac cgcgtgggtg      2940
     catgaaccgt atgccgcgca ttacgagttc acgagcgcgc tgtcggtgca gttgctgaag      3000
     tctttggcgc cggtcttgca gccgttgctg aatgagacgc ctgtgaagac ggcttcggtt      3060
     acgaaggttg ccgcgcaatg a                                                3081
//

If you have problems or comments...

PBIL Back to PBIL home page