(data stored in ACNUC7421 zone)

EMBL: CP001053.PE576

CP001053.PE576       Location/Qualifiers
FT   CDS_pept        complement(656785..658011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4578"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: bxe:Bxe_B0891 ROK"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4578"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18951"
FT                   /db_xref="GOA:B2TD37"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD37"
FT                   /protein_id="ACD18951.1"
FT                   /translation="METTGTRSPLKRTVGSNQVGMRQFNERIVLQAIRLHGPLPKADVG
FT                   RLTRLSMQTVSMIVERLIEDGLLEKQARVRGRIGQPSVPIALRAQGAYTIGIKVGRRSL
FT                   DVLAMDFAGHVVHRDVFDYAYPDPRTLFPALENKLARVNQTLGAKASQVVGVGVAAPLW
FT                   LGGWRDFLGAPPDALEAWNEIDLRSRIGTMTGLPVEFAKDTTAACAAELVMGQGRGIHN
FT                   FLYLFVGTFIGGGLVIDGRLHGGPHDNAGAVGSIPLREGGARKPARQLLHAASGFVLEK
FT                   LLTDAGAPAAAAHDHRALSPELWRHTEQWLDSACPAIATALTNAAALLDLDAIVIDGEL
FT                   DRQLLREIIRRTERVLDRFEWEGMVRPQLLEGAIGADARAMGGAILPLYAHFAPVHELF
FT                   LKPAAETVY"
     atggaaacca ccggcacccg ctcgcccctc aaacgcacgg tcggctcgaa tcaggtcggc        60
     atgcggcagt tcaacgaacg catcgtgttg caagcgatcc gcttgcatgg gccgctgccg       120
     aaagccgacg tgggccgcct cacgcgtctt tcgatgcaga ccgtgtcgat gatcgtcgag       180
     cgtctcatcg aagacggcct gctcgaaaag caggctcgcg tgcgcggcag gatcggccag       240
     ccgtccgtgc cgatcgcgtt gcgcgcgcag ggcgcgtaca ccatcggcat caaggtggga       300
     cgccgcagtc tcgacgtgct ggcgatggat tttgccggcc acgtggtgca ccgcgatgtc       360
     ttcgactacg cgtatcccga tccacgcacg ctgtttcccg cgctcgaaaa caaactcgcg       420
     cgcgtgaatc agacactcgg cgcgaaggcc agccaggtgg tcggcgtggg cgtcgcggcg       480
     cctttatggc tcggcggctg gcgagacttt ctcggcgcgc cgcccgacgc gctggaagcg       540
     tggaacgaga tcgatctgcg ctcgcgcatc ggcaccatga cgggcctgcc cgtcgagttc       600
     gccaaagaca ccacggctgc ctgcgccgcc gaactggtga tgggccaggg gcgcggcatc       660
     cacaattttc tgtatctgtt cgtcggcacg tttatcggcg gcgggctcgt gatcgacggc       720
     cgtctgcacg gcggcccgca cgacaacgcg ggtgcggtcg gctcgattcc gttgcgcgaa       780
     ggcggcgcgc gcaaacccgc gcgccagctg ttgcacgcgg cgtcgggctt cgtgctcgaa       840
     aagctgttga ccgatgcggg cgcgccggct gcggccgcgc acgatcatcg cgcactgtcg       900
     cccgaactgt ggcggcacac cgagcaatgg ctcgacagcg cgtgccccgc gatcgccact       960
     gcgttgacca atgcagccgc cctgctcgat ctcgacgcga tcgtgatcga cggcgaactc      1020
     gaccggcaac tgttgcgcga aatcattcgc cgcaccgagc gcgtgctcga tcgcttcgaa      1080
     tgggaaggca tggtgcgtcc gcaattactg gaaggcgcga tcggcgccga tgcgcgcgcg      1140
     atgggcggcg cgattctgcc gctctatgcg catttcgcgc cggtgcatga gctgttcctg      1200
     aagccggcgg cggagacggt ttattag                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page