(data stored in ACNUC7421 zone)

EMBL: CP001053.PE577

CP001053.PE577       Location/Qualifiers
FT   CDS_pept        complement(658042..658839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4579"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0892 ABC sugar transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4579"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18952"
FT                   /db_xref="GOA:B2TD38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD38"
FT                   /protein_id="ACD18952.1"
FT                   /translation="MSTPTSASSAMPVLQARGLIKRYGNVTALDGCDFEVMPGEIMAVI
FT                   GDNGAGKSSLIKALSGATVPDEGEILLDGKPVKFRSPLDARAQGIETVYQELAVAPAMS
FT                   IAENLFLARELLKPGWRGSIFKMIDKRRMLDEATAHMKDLQIGIRSMRQAVETLSGGQR
FT                   QGVAVARSAAFARHVVILDEPTAALGVKEGNMVLELIRRVRDRGLPVILISHNMPHVFE
FT                   IADRIHIQRLGRRAALVNRADIHMSEAVAIMTGAKEADVKAIA"
     atgtctaccc ctacttccgc ttcttccgcg atgcccgttc tccaggcgcg cggactcatc        60
     aaacgctacg gcaatgtgac cgcgctcgac ggttgcgatt tcgaagtgat gcccggcgag       120
     atcatggccg tgatcggcga taacggcgcg ggaaagtcgt cgttgatcaa ggcactttcc       180
     ggcgccacgg tgccagacga aggcgaaatt ctgctcgacg gcaaaccggt caaattccgc       240
     agcccgctcg atgcccgcgc gcaaggcatc gagacggtat atcaggaact cgccgtggcg       300
     ccggccatga gcatcgccga aaacctgttc cttgcgcgcg aactgctgaa acccggctgg       360
     cgcggctcga tcttcaagat gatcgacaag cgccgcatgc tggacgaagc gaccgcgcat       420
     atgaaggact tgcaaatcgg catccgctcg atgcgccagg ccgtcgaaac actttcgggc       480
     ggccagcgtc agggcgtggc cgtggcgcgc agcgcggcgt tcgcgcggca cgtggtgatt       540
     ctcgacgagc cgaccgccgc gctcggcgtg aaggaaggca acatggtgct cgaactgatc       600
     cggcgcgtgc gcgatcgcgg cctgccggtg atcctcatca gccacaacat gccgcacgtg       660
     ttcgagatcg cggaccgcat tcatatccag cggctcggcc ggcgcgcggc gctcgtgaac       720
     cgggcggaca tccacatgtc ggaggcggtg gcgatcatga ccggtgcaaa ggaagcagac       780
     gtcaaggcga ttgcatga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page