(data stored in ACNUC7421 zone)

EMBL: CP001053.PE581

CP001053.PE581       Location/Qualifiers
FT   CDS_pept        complement(662413..663444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4583"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   bvi:Bcep1808_3829 periplasmic binding protein/LacI
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4583"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18956"
FT                   /db_xref="GOA:B2TD42"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD42"
FT                   /protein_id="ACD18956.1"
FT                   /translation="MPTLSEVARHAGVTPATVSNVLRNRGRVGATTRQRVLEAVEALGY
FT                   RPHLAARALAEGRAPTLALMVSSIANPFYPEFALAVERAARTSGHFVIICNTNEDPHTG
FT                   RAYLDQIAGTLSEGVLVTNANLDLADLHTTESRGTPVVLCMWERPNEPPGLPCVAVDFR
FT                   RAGELAGAHLLELGHRRIGAIVGSKASGIHAARYEGFVDALRAGGAPKGRVKHAADTIQ
FT                   GGYEAARALLESDPKLTAIFVTNDLPALGAMHAAADLGLNVPTDLSVIGITDIQLARES
FT                   RPALTTVAVPTVEVAGLAVSLLRELIESSYGQAGRPTTSVPMRIASPPELVVRASTGVP
FT                   RSR"
     atgcccacac tcagcgaagt cgcgcgtcat gccggcgtca ccccggcgac ggtatccaac        60
     gtgctgcgca atcgcggccg ggtcggcgcg accacccggc agcgcgtgct cgaggccgtc       120
     gaagcgctcg gctaccgtcc gcatctcgcc gctcgcgccc ttgccgaagg tcgcgcgccg       180
     acgctcgcgc tgatggtgtc gagcatcgcc aatccgttct atccggagtt cgcgctcgcc       240
     gtcgaacgcg cggcgcgcac gagcggccac ttcgtgatca tctgcaatac gaacgaagat       300
     ccgcacaccg gccgcgcgta tctcgaccag attgccggca cgctctccga aggcgtgctc       360
     gtgacgaacg cgaacctcga tctcgctgat cttcatacga ccgaatcgcg cggcacgccg       420
     gtcgtgctgt gcatgtggga acggcctaac gagccgccgg ggttgccgtg cgtcgcggtc       480
     gatttccggc gtgccggcga actggcgggc gcgcatttgc tggagctcgg ccatcggcgg       540
     atcggcgcga ttgtgggcag caaagcgtcg ggcattcatg cggcccgtta cgaaggtttc       600
     gtcgatgcac tgcgcgccgg cggcgcgccg aaaggccgtg tcaaacatgc ggccgatacg       660
     atccagggcg gctacgaagc ggcacgcgcg ctgctcgaaa gcgatccgaa gctcaccgcg       720
     atcttcgtga ccaacgacct gcccgcgctc ggcgcgatgc acgccgccgc cgacctcggc       780
     ctgaacgtgc caacggacct gtccgtgatc ggcattaccg acattcaact cgcgcgcgaa       840
     tcgcgccccg cgttgacgac ggtcgccgtg ccgacagtcg aagtcgcggg gctcgcggta       900
     tcgctattgc gtgagctgat cgagtcgtcg tatggacagg cgggtcgccc aacgaccagc       960
     gtgccgatgc gcatcgcctc gccgcccgaa ctggttgtgc gtgcatccac gggcgtgccg      1020
     cgttcgcgct ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page