(data stored in ACNUC7421 zone)

EMBL: CP001053.PE582

CP001053.PE582       Location/Qualifiers
FT   CDS_pept        663638..664792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4584"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: bmu:Bmul_3198 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4584"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18957"
FT                   /db_xref="GOA:B2TD43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD43"
FT                   /protein_id="ACD18957.1"
FT                   /translation="MASISLRGVQKAYGEGAPVIRDVDLEIGENEFCVFLGPSGCGKST
FT                   LLRMIAGLEDLTDGDLSIGGKLMNDVPAAQRGVAMVFQSYALFPHMSVFENMAFGLKLA
FT                   KTPKDEVDRKVREAARILQLEALLERKPKALSGGQRQRVAIGRAIVREPGVFLFDEPLS
FT                   NLDATLRGQTRIEIARLHKQFAKASVVYVTHDQIEAMTLADKIVLLHAGKDTERYGSIA
FT                   QIGAPLELYHRPKSRFVAGFIGSPRMNFLPGRVASLDAQGVTITLDHTQETVRVPVNGA
FT                   GLQTSQAVTLGVRPEHLEFVDPSSVAPDDAVLTRTVSLVEQLGEHSYVHLDQPGGAALV
FT                   AKAPGNTRLAPGERASLRVPRAACHLFTEDGFAAASLESVEHYA"
     atggcgagca tttcgttaag aggcgtgcag aaggcgtatg gcgagggcgc gccggtgatc        60
     cgcgacgtgg atctcgagat cggcgaaaac gagttttgcg tgtttctcgg tccgtccggc       120
     tgcggcaagt cgaccttgct gcgcatgatt gccggactcg aagacctcac ggacggcgac       180
     ctctcgatcg gcggcaaact catgaacgac gtgccggccg cgcaacgcgg cgtggcgatg       240
     gtgttccaga gttacgcgct gtttccgcac atgagtgtgt tcgagaacat ggcgttcggg       300
     ctgaagctcg cgaaaacccc caaggatgaa gtcgaccgca aagtgcgcga agccgcgcgc       360
     atcctgcaac tggaagcgct gctcgaacgc aagcccaagg cgctgtcggg cggccagcgg       420
     cagcgggtgg cgatcggccg cgccattgtg cgcgagccgg gtgtatttct gttcgacgag       480
     ccgctctcca atctcgacgc cacgctgcgc ggccagactc gcatcgagat cgcgcggttg       540
     cacaagcagt ttgccaaagc cagcgtggtt tacgtgacgc acgaccagat cgaggcgatg       600
     acgctcgccg acaagatcgt gctgctgcat gccggcaagg acaccgagcg ttacggcagc       660
     atcgcgcaga tcggcgcgcc gctcgagttg taccaccgtc cgaagagccg ctttgtcgca       720
     gggttcatcg gttcgccgcg catgaacttt ttgccgggaa gggtcgcttc cctggatgcg       780
     caaggcgtca ccatcacgct cgatcacacg caagagactg tgcgcgtgcc ggtgaacggc       840
     gcggggctgc aaacctcgca agcggtcacg ctcggcgtgc gccctgagca tctggaattt       900
     gtcgatccgt cttccgtcgc gccggacgac gccgtgctga cacgcaccgt ctcgctcgtc       960
     gaacaactcg gcgaacacag ctatgtccac ctcgatcagc ccggcggcgc cgcgctggtc      1020
     gccaaagcgc cgggcaatac gcgcctcgca cccggcgagc gcgcgagctt gcgcgtgccc      1080
     cgtgccgcct gccatttatt taccgaagac ggctttgccg ccgcttcgct cgaatccgtc      1140
     gaacactacg catag                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page