(data stored in ACNUC7421 zone)

EMBL: CP001053.PE585

CP001053.PE585       Location/Qualifiers
FT   CDS_pept        668275..669252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4587"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcm:Bcenmc03_4576
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4587"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18960"
FT                   /db_xref="GOA:B2TD46"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD46"
FT                   /protein_id="ACD18960.1"
FT                   /translation="MSHSVTRHTVSGPAEPGGPGLPTPGGAVRGGKPASSRRRGPSPTA
FT                   RRQRRAAFLFLAPACVMVAIYVVWPILSTIRLSFFNWDGMSEPSFVGLANYVELFHAQT
FT                   FYTALKNNLIWLLLFLLAPPMGLAVALYLNQAVAGIRIVKSLFFAPFVLSGVVVGLIFS
FT                   WFYDPTFGLLAVILGHGVPVLGDPRYATFGIVFAALWPQTAYCMILYLTGLTSLNAEQI
FT                   EAARMEGARGWSMLWHVILPQLRPTTFMAIVVTIIGALRSFDLISVMTGGGPFESSTVL
FT                   AYYMYDQAIKYYRIGYSAAVAVVLFAIMLVYIVYHLRRMLRAEQ"
     gtgtcgcatt ccgtcacccg tcacactgtg agcggtcccg ctgaacccgg cggcccgggc        60
     ttgcccacgc cgggcggcgc cgtgcgcgga ggcaagccgg ccagttcgcg gcggcgcggt       120
     ccgtcgccca ccgcgcgccg gcagcggcgc gccgcttttc tgttcctcgc gccggcctgc       180
     gtgatggtgg ctatctacgt ggtgtggccg atcctctcca ccatccgcct gagctttttc       240
     aactgggacg gaatgagcga gccgtcgttc gtcggactcg cgaactacgt cgagctgttt       300
     catgcgcaga cgttctacac cgcactgaag aacaacctca tctggctgct gctgttcctg       360
     ctcgctccgc cgatgggact cgccgtcgcg ttgtatctga atcaggcggt ggccggcatc       420
     cgtatcgtca aatcgctatt cttcgcgccg ttcgtgttgt cgggcgtggt ggtcggtttg       480
     atcttctcgt ggttttacga cccgaccttc ggcctgctcg ccgtgattct cggccacggc       540
     gtgccggtac tcggcgaccc gcgctatgcg acgttcggga tcgtgttcgc ggcgctgtgg       600
     ccgcaaaccg cctattgcat gattctctat ctgaccgggc tgacctcgct gaacgccgag       660
     cagatcgagg ccgcgcgcat ggaaggcgcg cgcggctggt cgatgctgtg gcacgtgatc       720
     ctgccgcaac tgcggccgac cacgttcatg gcgattgtcg tgacgattat tggcgcgctg       780
     cgcagtttcg atctgatctc ggtgatgacg ggcggcggtc cgttcgaaag ctcgaccgtg       840
     ctcgcgtatt acatgtacga ccaggcgatc aagtactacc gcatcggcta ttcggcggca       900
     gtggcggtcg tgctgttcgc catcatgctg gtgtacatcg tttatcactt gcggcggatg       960
     ctgcgcgccg agcaataa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page