(data stored in ACNUC7421 zone)

EMBL: CP001053.PE587

CP001053.PE587       Location/Qualifiers
FT   CDS_pept        670686..673034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4589"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4589"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18962"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD48"
FT                   /protein_id="ACD18962.1"
FT                   /translation="MGSRPISAGFWRHLGRRAIPHSDRDKTLLGLQAAKALGNVAGFTI
FT                   DYARVPDKGASVRNFAYGARSHGAYSLVDSGAIQEIELTHFKPAPQSRYAQTSEPATGE
FT                   AHTQTPPPESTGSQTERQDKLPAHTQTQTGSSDKATQTSTSTRAGSSQTGTNGGDIAGN
FT                   RTTSSSSDEKGTQTHIQLVSEKTQAHSHGQDAETQTQRRETTDAENQAKPKVSHKGVLA
FT                   RVPRQEQSVQTHSSGPVDSSVQTEARVKNSKTQTGADVHDATVQTGSSSKTDTATQTVS
FT                   SRSSVGTRTATTSHNVQVQTAPSNARELIPQTSASLYDPRKRSPREGIQPTPRHHAGSQ
FT                   TVLPRTDQGSQANVKTQDRNTQSSLPTKEDQSSQTRVFSKDSEIQVTSPSRTRSTQTTQ
FT                   APHIGVPSFKPQRPAVPSTVKANGHWLVIDAFALASSGSNLKGDPSQMNRLTLASDSIS
FT                   SAGDVAATINLGGNEVLALTGKTLSLLGTAIGLAPSVAQLSSDIKTLIAHPENEQAKWN
FT                   VGNSAVQLFGGLLATAASFAFPPAALVPLLFPNFAEIGHAEDLRKQEAELRAQGRTAEA
FT                   DVVHGEYVKAALNATPIINWFSSFYTPAMRPAIERFELSHGNKPGSPPRGDLRPGERGD
FT                   PAVADYYGQAIQQRGQSLAAAATPYLKEVLKGTNADSITFVSRAPQMFGWPSTGQPMRM
FT                   FDRAIAITYSKKTGLCTFQFFGKDKDGVFRLPILNEGVATDDHQKNIVLMGNQLDPDKQ
FT                   KVKFDLEAYRNAPHGQMIVVDPNNYRLGA"
     atgggatcgc ggccaatttc cgccggtttc tggaggcact tgggcaggag agcgatcccc        60
     catagtgaca gagacaaaac gttgctggga ttgcaggcgg ccaaggcgtt ggggaatgtg       120
     gcgggattca caatcgacta tgcaagggtg cctgataagg gagcaagcgt gcgtaacttc       180
     gcatacgggg ctcgaagcca tggagcgtat tcgctggtgg attcaggagc aatacaggaa       240
     atcgagctga ctcatttcaa gccggccccc caatcacgct acgctcaaac ttctgaacct       300
     gcgactggcg aggcgcatac gcaaacgccg ccgcccgagt cgaccggctc gcagaccgag       360
     cggcaggata agttgcctgc ccacacgcag acgcaaaccg gcagttctga caaggcgaca       420
     caaacgtcga cttccacgcg cgctggctcg agtcagactg gtacgaacgg tggagatatc       480
     gcgggcaaca ggacaacctc gtcgagcagc gatgaaaagg gaacgcaaac gcacatacag       540
     ctcgtcagcg aaaagactca ggctcattcg cacggacagg atgcagaaac ccagacgcag       600
     cggcgggaaa caacggatgc cgaaaaccag gcaaagccaa aagtctcgca caaaggcgtg       660
     ctcgcacgcg ttccccgaca ggagcagtcc gttcagactc actcgtccgg accggtagat       720
     agctctgtgc aaaccgaggc gagagtaaaa aatagcaaaa cgcaaacagg ggctgatgtg       780
     cacgatgcca ccgtgcaaac aggcagttca tcgaagactg acacggcgac tcaaacggtc       840
     tcgtccaggt cctccgtcgg aacgcggact gcaacgacca gccacaatgt gcaggtacag       900
     acggcaccgt caaacgcccg cgagttgatc ccgcagactt ctgcttcttt atacgaccca       960
     aggaagcgga gtcctcgaga aggaattcaa ccgacaccca ggcatcatgc cggatcccaa      1020
     actgtgttgc cgcggacaga tcaaggatcg caggcgaatg tgaagactca ggaccgtaac      1080
     actcaaagct ccctcccgac caaagaggat cagagcagtc aaacaagggt ctttagcaaa      1140
     gatagcgaaa tacaggtcac gtctccctcc cgaaccaggt ctacccagac tactcaagct      1200
     cctcacattg gcgtgccctc gttcaagcct cagcgcccgg ccgtcccgtc caccgtaaag      1260
     gccaatggcc actggctggt aatcgatgca ttcgcgctgg catcaagcgg ctccaatcta      1320
     aaaggcgatc caagtcagat gaacaggctg acactcgcct ccgactctat tagcagcgct      1380
     ggcgacgtag ccgccacgat caatctcggc ggcaatgagg tgcttgcctt gacggggaaa      1440
     acgctgtcgc ttctcggcac ggcgatcggg cttgcaccat ctgttgcgca gctatcgtcc      1500
     gatatcaaga ccctgattgc tcaccccgaa aacgagcagg cgaaatggaa cgtaggcaat      1560
     agtgccgtgc agctcttcgg tggccttctc gcgacggctg cttcgtttgc ctttcctccg      1620
     gctgcccttg ttcccttgct atttccgaat ttcgccgaga ttggtcacgc cgaagacctg      1680
     cggaagcagg aagccgaatt gcgagcgcaa gggcggactg cggaagccga cgtcgtccat      1740
     ggagagtatg taaaagctgc actcaacgcg acaccaatta tcaactggtt ctcctcgttc      1800
     tacacgcccg ccatgcggcc tgccatcgag agattcgagc tatctcacgg aaacaagccc      1860
     ggctcaccgc cgcggggcga tctgaggcca ggcgagcgag gtgacccggc tgtggcggac      1920
     tactatggtc aggccatcca gcagcgtggc caaagtcttg ctgcagccgc aacgccttat      1980
     ctgaaagagg ttctgaaagg gacgaacgcg gattcgatta cattcgtatc gcgagctccg      2040
     caaatgtttg gctggccatc gaccggccag ccgatgcgta tgttcgatcg cgctatcgcg      2100
     attacttatt cgaagaaaac tggtctgtgc accttccagt tcttcggtaa ggacaaggac      2160
     ggggtcttcc gtcttccgat attgaatgag ggcgtagcaa cggacgatca ccagaaaaac      2220
     atagtcctga tgggtaatca gttagatccg gacaagcaga aggttaaatt cgatctcgag      2280
     gcataccgca atgcgccaca tggccagatg attgttgtcg atccaaacaa ctacaggctt      2340
     ggcgcatag                                                              2349
//

If you have problems or comments...

PBIL Back to PBIL home page