(data stored in ACNUC7421 zone)

EMBL: CP001053.PE59

CP001053.PE59        Location/Qualifiers
FT   CDS_pept        complement(64143..65402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4050"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18434"
FT                   /db_xref="GOA:B2TEB3"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB3"
FT                   /protein_id="ACD18434.1"
FT                   /translation="MNASIAFVPSYRESQLTGWHSVGAWAISFSYLLFCISDTLLSLEM
FT                   DGSQLVKLGAFVLLAVAILLRPRFHKLIALIVPFMLALYIAMWRAFNVNAGGEEFLRFL
FT                   APMAITVAIFAYRSKLAPVLFMFFAVVLSNDLFQCYFYLAYGLKLPLFLPVKFDSGLYL
FT                   RAQGWIGFFSEFSFINFCAFLVCRHYRPTRRSQRAAWIFLTFALLGVSFKIFATIAMYF
FT                   IVARKLTVRSFIAALSAIGLVLFALMAGLLDSLIKIAMTKISFYVVAGNSARAESYRVM
FT                   FQSLMKGNIFGEGLGSFGGPASVKYHSPLYSIYHFNWYGLGNTLTTTDTFYPHLFVELG
FT                   VLGAILWLAFMLLYGQVSKRRRVWLFLVGAFCFDNIFSMSFVSASYVFSALMLMYLFSD
FT                   NGSLISRPPSAAGKRAGAMR"
     atgaacgcta gcattgcgtt tgtgccttcc tatcgcgaat cgcagctgac cggatggcat        60
     tccgtgggcg cgtgggcgat atctttctcc tatctgctat tttgcatcag cgatacgctt       120
     ctttcacttg aaatggacgg gtcccagctc gtcaagctcg gtgcatttgt cttgctggcc       180
     gtcgcgattt tgcttcgccc gagatttcac aagctcatcg cattgatcgt ccctttcatg       240
     ttggcgctct atatagccat gtggcgagca ttcaacgtca atgcgggtgg ggaagagttt       300
     ttgcggtttc tcgcacccat ggcgatcacc gtcgcgatat tcgcgtacag aagcaagctt       360
     gcgccggtcc tcttcatgtt ctttgccgtc gtattgagca acgatttatt tcaatgttac       420
     ttttaccttg cttatggatt gaaacttccg ctgtttttgc cagttaagtt tgattcgggt       480
     ttgtatctga gggcacaagg atggatcgga ttcttctcag aattcagttt catcaatttc       540
     tgcgcgtttc ttgtgtgccg ccactaccgg ccgacccggc gatcacagcg agcggcgtgg       600
     atttttctga catttgccct cctgggagtc tcattcaaaa tcttcgctac gatcgcaatg       660
     tatttcatcg tcgcgagaaa gctgaccgta cgctccttca tcgccgcgtt atccgcgatt       720
     ggcctcgtgc tgtttgctct gatggcgggg ctgcttgatt cgttaatcaa gatcgcaatg       780
     accaagatct ccttctacgt cgtagctggg aattcggcgc gcgcggagtc gtatcgcgtc       840
     atgttccagt cgctgatgaa agggaacatt ttcggtgaag ggctcggctc ctttggtgga       900
     ccagcctccg tcaagtacca ctcaccgctt tacagcatct atcacttcaa ctggtatggg       960
     ctcggaaata ccctgacgac taccgacacg ttctatccac atctttttgt tgaacttggt      1020
     gtattgggcg ccatcttgtg gctcgcattt atgctcctgt atggacaggt tagcaagcgt      1080
     cgacgtgtct ggctattttt ggtcggtgcg ttttgcttcg acaacatctt ctcaatgtca      1140
     tttgtttcag catcctacgt cttctcagcg ctcatgctca tgtatctgtt ttctgacaat      1200
     gggtccctga tctcgcgacc cccgtcggct gcggggaaac gtgccggagc catgcgatga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page