(data stored in ACNUC7421 zone)

EMBL: CP001053.PE592

CP001053.PE592       Location/Qualifiers
FT   CDS_pept        complement(677270..679615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4595"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; Cna B domain protein;
FT                   TonB-dependent receptor plug; KEGG: bxe:Bxe_B0900
FT                   TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4595"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18967"
FT                   /db_xref="GOA:B2TD53"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD53"
FT                   /protein_id="ACD18967.1"
FT                   /translation="MTIRTRVSSAALLLFAMAAHAHAATDESSVTGAVTDAAGQPVNNA
FT                   TVIVQNASGAAVTEAKTNAEGRFAIAHVTPGTYAIVVTAPGFASGNSITTTSAGAESTV
FT                   SVSLAKSGTLDVQVNAKRLDRARNGLLPETGSSVYRFSQADIEALPAGQDTPLNQVLLQ
FT                   APGVASDSYGQLHVRGDHANLQYRINGIIIPEPISGFGQALDTRIIDQVNLLTGALPAQ
FT                   YGYRTAGVVDIRTKTGDAGNGGTIDVFGGSHQTLKTSADVFGTQGPFSYYFSGSLGVNN
FT                   LGIENPTASASALHDHTRQGDAFGYMSYIINPLTRVSLMFGTTSNQFEIPNTPGLPTNF
FT                   TLNGNNAFDSSQLDETQSELNNFAVLALQGTNGGALDYQVALFTRYTRTQFNPDPVGDL
FT                   LFNGVASQDFHSNSANGAQVDTTWRLNEKHTIRAGLFFQQEHAVFDDSVDVFAADSEGN
FT                   QLSDQPFNIHDSSSRTGYLYSAYVQDEWKITDKLTLNYGLRYDKMDEYVSASQLSPRIG
FT                   LVYALTPTTTFHAGYARYFTPPAFELVSGSTISRFNGTTNQSPSSQNDQVQPERSHYFD
FT                   LGVTQRLGSNVTVGIDAYYKKSTNLLDEGQFGSALIFTPFNYQYGRVYGLEFTANYKQD
FT                   NASAYLNFAYSRAQGKQIDSAQFNFEADELAYINDHWVYLDHDQRITASFGGTYDLGRT
FT                   TFTFDGLVGSGLRSGFANTDRLPVYAQINLGVIQHFNQPLVGKFDARLLVVNAFNRVYE
FT                   LRDGSGIGVGAPQYGPHFAVYAGITKHF"
     atgacaatcc gcacgcgcgt ctcctctgca gctttgctgc tgttcgccat ggccgcccac        60
     gcccacgccg cgactgacga aagttcagta accggcgcag tcacagacgc cgccggccaa       120
     cccgtcaaca acgccacggt aatcgtgcag aacgcgagcg gcgccgctgt caccgaggcg       180
     aaaacgaacg ccgaaggccg cttcgccatc gcgcacgtga caccgggcac ctacgcgatc       240
     gtcgtcaccg caccgggatt tgcgagcggc aacagcatca ccaccacgag cgccggcgcg       300
     gaaagcaccg tcagcgttag tcttgcaaag agcggcacac tcgacgttca ggtgaacgcg       360
     aagcgactgg acagagcgcg taatgggttg ttgcccgaga ccggcagcag cgtgtaccgc       420
     ttcagccagg ccgatatcga agcgctaccc gcaggccagg acacgccact gaatcaggtg       480
     ctgctgcaag cgcccggcgt ggccagcgat tcatacggac aacttcacgt gcgcggagac       540
     cacgccaatc tgcaatatcg catcaacggg atcatcattc ctgaaccgat cagcggcttt       600
     gggcaagcgc tcgacacgcg catcatcgac caggtcaatc tgttgaccgg ggctttaccg       660
     gcgcagtacg gctaccgcac ggccggtgtc gtggacatcc gcacgaaaac cggtgacgcg       720
     ggcaacggcg gcaccatcga cgtgttcggc ggcagccacc agaccctcaa gaccagcgcc       780
     gacgtgttcg gcacgcaagg tccgttcagc tactacttca gcggctcact tggcgtcaac       840
     aacctcggca tcgagaaccc gaccgcaagc gcgagcgcgc tgcatgacca cacccgtcag       900
     ggcgatgcgt tcggttatat gtcatacatc atcaatccgc tcacgcgagt gagcctgatg       960
     ttcggcacca cgagcaacca attcgaaatc cccaacacgc cggggcttcc aacaaatttc      1020
     acgctcaacg gcaacaacgc gttcgattcg agtcagttgg acgagacgca atcggagttg      1080
     aacaattttg cggtgctggc gcttcaaggc accaatggcg gcgcactgga ctaccaggtc      1140
     gcgctattca cccgttacac gcgaacgcaa ttcaatcccg atccggtggg cgacctgctt      1200
     ttcaacggcg ttgcgtccca ggactttcac agcaactcgg ccaacggtgc gcaagtcgac      1260
     accacgtggc gactcaacga gaagcatacg attcgcgccg gcctcttttt ccagcaggaa      1320
     cacgcggtat tcgacgacag cgtcgacgtg ttcgcagccg actccgaggg caatcagcta      1380
     tccgaccagc ccttcaatat ccacgactcg agcagcagaa ccggctacct gtacagcgca      1440
     tacgtgcaag acgaatggaa aatcaccgac aagctcacgc tcaattacgg gctgcgttat      1500
     gacaagatgg atgagtacgt cagtgcgagc cagttgagtc ctcgcatcgg gctggtctat      1560
     gcgctgacgc cgaccaccac ctttcacgcc ggctatgcgc gctacttcac accacccgca      1620
     ttcgaactgg tgtccggctc caccatcagc cgcttcaacg gcaccactaa ccagagtccg      1680
     tcgagtcaga acgatcaggt gcagccggaa cgcagtcatt atttcgacct cggcgtcaca      1740
     cagcgtctcg gttcgaacgt gacggtcggc atcgacgcct actacaaaaa atccactaac      1800
     ctgctcgacg aaggtcagtt cggctccgcc ctcatcttca cgccgttcaa ctatcaatac      1860
     ggacgcgtgt acggactcga attcaccgcg aattacaagc aggacaacgc gtccgcctat      1920
     ctgaacttcg cctacagccg cgcgcaaggc aaacaaatcg actcggctca gttcaatttc      1980
     gaagcggacg aacttgccta catcaacgac cattgggtgt atctggatca tgaccaacgc      2040
     atcaccgcgt cattcggcgg cacgtatgac ctcggcagaa cgacattcac cttcgacggc      2100
     ctggtgggca gcggcctgag aagcggcttc gccaacaccg atcgcctgcc cgtctatgcg      2160
     cagatcaatc tcggcgtaat ccagcatttc aaccagcctc tagtgggtaa gttcgatgcg      2220
     cgcttgctgg tcgtcaatgc attcaaccgc gtttatgaat tgcgtgacgg ctcgggcatc      2280
     ggagtgggcg cgccgcaata cggcccgcat ttcgccgtct acgccggtat caccaagcat      2340
     ttctaa                                                                 2346
//

If you have problems or comments...

PBIL Back to PBIL home page