(data stored in ACNUC7421 zone)

EMBL: CP001053.PE594

CP001053.PE594       Location/Qualifiers
FT   CDS_pept        complement(681088..681438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4597"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18969"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD55"
FT                   /protein_id="ACD18969.1"
FT                   /translation="MKKALVCFALALGTLAAPVVSFAQSNGPVTRAEVRADLVRLEQAG
FT                   YNPSLGNDADYPAAIQAAEAKVAAQTAPQTTQPSYGGVGQKGTSSSGMRKHASTDSSCV
FT                   GPVSFCNVFFGS"
     atgaaaaaag ctcttgtttg tttcgctctc gctctcggca cgctggccgc ccctgttgtg        60
     agcttcgcac aatctaatgg ccccgtcaca cgtgctgagg tccgcgccga tctggtacgc       120
     ctcgaacagg ctggctacaa cccttcgctt ggcaacgacg ctgattatcc ggccgccatt       180
     caggcagccg aagcaaaggt cgccgcacag accgctccgc agacgacgca accgtcgtac       240
     ggaggcgtgg ggcaaaaagg cacttcttcg tccggcatgc gcaagcacgc gtcgaccgat       300
     tccagttgcg tcggccccgt cagtttctgc aatgtcttct tcggcagctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page