(data stored in ACNUC7421 zone)

EMBL: CP001053.PE60

CP001053.PE60        Location/Qualifiers
FT   CDS_pept        complement(65399..66730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4051"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18435"
FT                   /db_xref="GOA:B2TEB4"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB4"
FT                   /protein_id="ACD18435.1"
FT                   /translation="MKQGNANAVRRRLRFDALAGAVSVERIEALICTGSPGLYRVVVFF
FT                   AVQHVYSLAELGRTASSMSIAQMVAFFTAIGWATLILVRVPAATTEQGAIAVFYRVATM
FT                   SLATTVLCTLLALTIAFFKTVQFDLPAFVALLWGWTAYQIARHYFVALKRFRIAIAFDI
FT                   ALIASSGGMLALCHRGGLSADNAVAMALGAIAIAMFVRIGRPALDVLPKRLDTEGLQFG
FT                   LTNFLSGGIQLVFVPAATIMCGAAFAGMLSLLSSVTAIGMLLPRAISMTQLADLAKRKA
FT                   ASLSLDDSLHTMSRNIGWCNGAMLVFNVILVLLLAARPVHGAAHQSGIIVAGLLLAIQC
FT                   AVGMMGIANSSIMMVFERGGSAAKINIFTTSAFALLAVPCYAYGGQSGLMMILCAAIAV
FT                   TVWRNWLIRCCARQIHSRYVDLCGSAAVSDVKCQVQPLACGASR"
     atgaagcaag gaaacgcgaa tgcggtgcgc cggcgtctca ggttcgacgc gctggccggc        60
     gccgtgtccg tcgaacgcat cgaagccctg atctgtaccg gatcgccagg gctttaccgc       120
     gtggttgttt tcttcgcggt tcagcatgtc tattcgcttg cggagctcgg acgcactgca       180
     tcgagcatgt cgatcgcgca gatggttgcg ttctttactg caattggatg ggcgacattg       240
     atactggtgc gtgtgcctgc ggccacgacc gagcaaggcg cgatcgcggt attttatcga       300
     gtcgcgacga tgagtcttgc cacgactgtc ttgtgcaccc ttctcgcact gaccatcgct       360
     ttcttcaaaa cagttcagtt tgatctgccc gcattcgtcg cgttgctgtg gggttggacg       420
     gcttaccaga tcgcgcgcca ctactttgtt gctctaaaac gcttccgcat cgcgattgcc       480
     ttcgatatcg cactgatcgc cagttcgggg ggcatgctcg ccctttgcca tcgtggcgga       540
     ctgtcggccg acaacgcggt ggcaatggca cttggcgcaa ttgccattgc gatgttcgtc       600
     cgaatcggtc gaccagcgct cgacgtgttg ccaaagagac tggacaccga gggactccag       660
     ttcggactta caaatttctt gtccggtgga attcaattgg tcttcgtgcc ggcggcgaca       720
     atcatgtgtg gcgccgcgtt tgccgggatg ctatcgctac tttcgtcagt taccgcgatc       780
     gggatgctac tgccgcgcgc gatatcaatg acgcagttgg cagatctcgc caagcgcaag       840
     gcagcctcgc tttctctcga cgattcgctt catacgatga gccgcaatat tggttggtgt       900
     aacggagcga tgctggtttt caacgtcatt ctggttctgc tgctagccgc gaggccggta       960
     cacggtgccg cgcatcagtc gggcatcatc gttgccggcc tgttgcttgc aatccaatgc      1020
     gcggtcggca tgatgggtat cgcaaacagc agcatcatga tggtgttcga gcgaggcggc      1080
     tcggcggcga aaataaacat cttcacgacg tcggcgttcg cattgctcgc tgttccttgc      1140
     tatgcatacg gaggccaaag cggtctcatg atgattctgt gtgcggcgat agcggtcaca      1200
     gtctggcgta attggctgat cagatgctgc gcccgccaga ttcatagccg atacgtcgat      1260
     ctctgcggat cggccgctgt ttccgacgtg aaatgccaag tacaaccgct agcctgtgga      1320
     gcgtcccgat ga                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page