(data stored in ACNUC7421 zone)

EMBL: CP001053.PE62

CP001053.PE62        Location/Qualifiers
FT   CDS_pept        complement(68137..70359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4053"
FT                   /product="exopolysaccharide transport protein family"
FT                   /EC_number="2.7.10.2"
FT                   /note="KEGG: bxe:Bxe_B0507 exopolysaccharide transport
FT                   protein/putative tyrosine protein kinase; TIGRFAM:
FT                   exopolysaccharide transport protein family; capsular
FT                   exopolysaccharide family; PFAM: lipopolysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4053"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18437"
FT                   /db_xref="GOA:B2TEB6"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005700"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB6"
FT                   /protein_id="ACD18437.1"
FT                   /translation="MKNQFSRDEDEIDIRALIDVIFKNKKLIIAVTIVCTLIGVMYAFL
FT                   ATPIYRGDITVQVEDNSDLAGAAAGNLMSGLTSLFDIKSTDDGEMQILDSRLVTANMVD
FT                   ELRLYIDARPKYFPLLGAFIAKHRTSLSQPGILGVGGYAWGSESIVVDQFDVPGEFEED
FT                   KFSVTTLGNNRYRLSGSDLNADVVGVVGVPLLANTSSGPIKLLVSRLSSRENAQFELRR
FT                   FSRIQVLEQLRKDLVITEMGKDQSGVIGVTYDDQDPARAAAVLNKIAENYVAQNADRKA
FT                   AAAEKSLVFLKSQLPDVERSLRLAEDRLNAYQNRHKVVDLSEQAKAVLGQAVEAQSSLF
FT                   QLEQKRKELATIYSAQYPAVLALDQQIAAARAHIDNFNESIQRLPDDQQNIVRLNRDVT
FT                   VQTSLYVGLLNSVQQLQLATASKIGNVRVIDHALVADKPTKPKKALVIALAAVIGLFGG
FT                   IGFALARSTLFGGLTDPMDIERDLSLDVIATIPLSDTQRQLTRVRERGGRRGPSILALA
FT                   RPQEPAVEAIRSLCTALQFALLENPKNNVILMTGPSVGIGKSFTSANLAALLGMSKKRV
FT                   LLMDVDLRRGHLAAEFDVSGKVGLSNVLRDDMPLEAAIIKDVSPNVDFLATGPLMAQPV
FT                   ELLSSGGIAKILADVSGRYDIVLLDAPPVLPVTDATVFAPFAGIVLLAARSGMTSSGEL
FT                   LESAKRIERVGAKITGIVFNGFKPSLRSAQYGDYGGYAYLSNASDT"
     atgaaaaatc aattttcccg tgacgaggac gaaattgaca tccgtgcact catagatgtc        60
     attttcaaga ataagaagct gatcattgcg gtcactatcg tgtgcacgct catcggggtc       120
     atgtacgcat tcctggcaac gccgatttac cggggtgata taacggttca ggtagaagac       180
     aactcagacc ttgcaggcgc ggcagccggc aacctcatga gcggattgac gtccctgttc       240
     gacatcaaat caacagacga cggcgaaatg caaatcctcg actcgcgact tgtcaccgca       300
     aacatggtcg acgaattgcg cctctacatc gacgccagac ccaaatactt tccgttgctt       360
     ggggcattca ttgcgaagca tcggacttcg ctatctcagc cgggaattct cggcgtaggc       420
     ggctatgcgt ggggctcgga aagcatagta gtcgaccaat tcgacgtgcc tggtgagttt       480
     gaagaagata agttctccgt caccacgctg ggcaacaacc gatatcggct ctcgggcagc       540
     gatctcaacg ccgatgtcgt tggtgtggtc ggcgttccct tgttggcgaa cacctcttcc       600
     gggccgatca agctgctggt gtcgcggttg agcagcagag agaacgcaca attcgagttg       660
     cgacgctttt cccgaattca agtcctcgaa cagttgcgaa aggatctggt gatcacagag       720
     atgggcaagg atcaatccgg cgtcatcggc gtgacttatg acgaccagga cccagcccgc       780
     gcagcggcag tattgaacaa gatcgcagaa aactacgtcg cgcaaaatgc cgaccgcaag       840
     gccgcggcgg cggaaaagtc cctcgttttc ctgaaaagcc aacttccgga cgtagagcgc       900
     agcctgaggc tggctgaaga ccgtctcaat gcctatcaga accgccacaa agtcgtcgat       960
     ctcagcgagc aggcgaaggc cgtgctcggc caggccgtcg aggcgcagtc cagcctgttc      1020
     caactcgagc aaaaacgtaa ggaacttgca acgatctata gcgctcaata tcccgccgtg      1080
     ctcgcactgg atcaacaaat cgccgccgcg cgcgcgcata tcgacaattt caacgagtcg      1140
     atccagcgcc ttcctgacga tcagcaaaat atcgtccgac tgaatcgcga cgtgactgtt      1200
     caaacaagcc tgtatgtcgg attgctcaat agcgttcaac aactgcaact tgctacggca      1260
     agcaagattg ggaacgtccg cgtaatcgat cacgcactgg tcgccgacaa accgacaaag      1320
     ccgaagaaag ccctcgttat tgcattggca gccgtcatcg ggttgtttgg cggaatcggt      1380
     ttcgccttgg cgcgttcaac gctgtttggc ggcctgactg acccgatgga tatcgaacgt      1440
     gatctgtctc ttgacgtcat tgccactatc ccgctgagcg atacccagcg tcaactgacg      1500
     cgagtcaggg aacgaggcgg ccgtcgcggt ccgtcgattc tcgcactggc gcgcccacaa      1560
     gaacccgcag tcgaagccat tcgaagcctc tgcaccgcgt tgcagttcgc gctgctggag      1620
     aacccgaaga ataacgtcat tttaatgact ggaccttccg tcggtattgg caagtcattc      1680
     acatccgcaa acctcgcggc tctgctggga atgtccaaga aacgtgtgct cttgatggat      1740
     gtcgatcttc gccggggcca tctggctgct gagttcgatg tgtccggcaa agtcggactc      1800
     tccaacgtgc tccgggatga catgccgctg gaggcggcca tcatcaaaga tgtgtctccg      1860
     aacgtggact tcctcgctac gggtccgttg atggcgcagc cggtcgagtt actgtcttcg      1920
     ggcggcatcg ccaaaattct ggcagacgtg tccggccgat acgacattgt cctcctggat      1980
     gcaccgccgg tgcttccggt cacagatgcg acggtcttcg cgcctttcgc cggaattgtt      2040
     cttctggcgg cacgttcggg catgaccagc agtggcgagc ttctcgaatc cgcaaaacga      2100
     atcgaacgtg tcggagcaaa gattaccggc atcgtcttca acggcttcaa accaagcttg      2160
     cgctctgcac agtacggaga ctatggcggt tatgcgtatt tgagtaacgc gtcggacacg      2220
     tga                                                                    2223
//

If you have problems or comments...

PBIL Back to PBIL home page