(data stored in ACNUC7421 zone)

EMBL: CP001053.PE63

CP001053.PE63        Location/Qualifiers
FT   CDS_pept        complement(70416..70868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4054"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: bxe:Bxe_B0508 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4054"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18438"
FT                   /db_xref="GOA:B2TEB7"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB7"
FT                   /protein_id="ACD18438.1"
FT                   /translation="MINTVLIVCEGNLCRSPMAQGLLQRELSDIEVTSAGLSAAKGAPM
FT                   DRFAREMLADRGIDMSSHVARRLNERVCGAADLILVMELAQKQAIEKFYPTARGRVYRL
FT                   ADADHVDVPDPFGRSARIYDQAMTLIERGVLDWTRRIVDLSRGLRA"
     atgatcaata cggtactcat agtctgcgag ggtaacctct gtcgcagtcc gatggcgcaa        60
     gggcttttac agcgggaact gtccgacatc gaagtgacgt cagccggtct ttccgccgcc       120
     aaaggtgcac cgatggaccg cttcgcgcgc gagatgctag cggaccgggg gatcgatatg       180
     tcgtcacacg tagccagacg tctcaacgag cgagtgtgtg gcgcggcgga cctgattctt       240
     gtcatggagt tggctcagaa gcaggcaatc gaaaagttct atccgactgc acgcggtcgg       300
     gtctatcgac tggcagatgc cgatcacgtc gatgtgccag atccgtttgg ccgatccgcg       360
     cgcatctacg atcaggctat gaccttgatt gaacgcggcg tgctggattg gacaagacgc       420
     attgtggatc tgtcccgggg cttgcgtgca tag                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page