(data stored in ACNUC7421 zone)

EMBL: CP001053.PE69

CP001053.PE69        Location/Qualifiers
FT   CDS_pept        77907..78833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_A2683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4060"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18444"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEC3"
FT                   /protein_id="ACD18444.1"
FT                   /translation="MLPMGVEEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEV
FT                   PEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPE
FT                   VPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVP
FT                   EVPEVPEVPEVPEVPEVPDPDVPPKPPPPSPGLGVLSVDPHPYSASNVDVATAMAVRPA
FT                   NFFMMSPLNDYWRGHCCKLHAKCHLWRDLAFKAQVYRKNKTQEEFTPTESQFPSQRQTR
FT                   VPRACYVTRAQTVTVRNTPQSSRSTFA"
     atgttgccga tgggggtgga ggaggtgcct gaagtaccgg aggtgcccga agtacccgag        60
     gtgcccgaag tacccgaggt gcccgaagta cccgaggtgc ccgaagtacc cgaggtgccc       120
     gaagtacccg aggtgcccga agtacccgag gtgcccgaag tgcccgaagt accggaggtg       180
     cctgaagtac ccgaggtgcc cgaagtaccc gaagtacccg aggtacccga ggtacccgag       240
     gtgcccgagg tgcccgaagt acccgaagta cccgaagtac ccgaagtacc cgaagtaccc       300
     gaagtacccg aagtacccga agtacccgaa gtacccgaag tacccgaagt acccgaagta       360
     cccgaagtgc ccgaagtgcc cgaagtgccc gaagtacccg aagtgcccga agtgcccgaa       420
     gtgcccgaag taccggaggt gcccgaagta ccggaggtgc ccgaagtacc ggaggtgcct       480
     gaagtcccgg aggtgcccga agtccccgaa gtccccgaag tccccgaagt ccccgaagtc       540
     cccgaccccg acgtaccacc caaaccgcca ccgccgagtc cgggacttgg ggtgttaagc       600
     gttgatccgc atccgtacag cgcgagtaat gtagacgtcg cgacagcgat ggctgtccga       660
     ccggcaaatt ttttcatgat gtccccgttg aacgactatt ggcggggaca ctgctgcaag       720
     ttgcacgcca aatgtcattt atggcgtgat cttgctttca aagcgcaggt atatcgaaaa       780
     aataaaacac aagaagaatt tactccgaca gaatcccaat ttccgtctca acgacaaacc       840
     cgtgttccgc gcgcgtgcta cgtaacgcga gcgcagaccg taacggtgcg aaacacgccg       900
     caatcatcgc gcagcacctt cgcatag                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page