(data stored in ACNUC7421 zone)

EMBL: CP001053.PE7

CP001053.PE7         Location/Qualifiers
FT   CDS_pept        6831..7265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3996"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3996"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18382"
FT                   /db_xref="InterPro:IPR025512"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE61"
FT                   /protein_id="ACD18382.1"
FT                   /translation="MYKIIAVAALVMSAALASPNAAIAGTTPAPAGAHEYIGYPNDGQV
FT                   VPANKPFKVWFGLRYMGVAPKGVKYPNTGHHHLLIDTDLPPMDQEIPSDRNHLHFGAGE
FT                   TETMIQLPPGKHTLQLLMGDDMHVPHNPPVYSKKITVIAR"
     atgtacaaga tcattgcggt cgcggcgctc gtcatgtcgg cggcattggc ttcgccgaat        60
     gccgccattg caggtacgac acccgcgccg gccggcgcgc acgagtatat cggctatccc       120
     aacgacggcc aggtggttcc cgccaacaaa ccgttcaagg tgtggttcgg cctgcgctac       180
     atgggcgtgg cgccgaaggg cgtcaagtat ccgaataccg gccaccatca tctgctgatc       240
     gatacggact tgccgcctat ggatcaggag attccgtcgg atcgcaatca tctgcacttc       300
     ggcgcgggtg aaacggagac catgattcaa ctcccgccag gcaagcacac gttgcagttg       360
     ctgatgggcg acgacatgca tgtgccgcac aatccgccgg tgtattcaaa gaagatcacc       420
     gtcatcgcgc ggtga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page