(data stored in ACNUC7421 zone)

EMBL: CP001053.PE76

CP001053.PE76        Location/Qualifiers
FT   CDS_pept        83827..85935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4067"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bxe:Bxe_B0521 iron-hydroxamate transporter permease
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4067"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18451"
FT                   /db_xref="GOA:B2TED0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED0"
FT                   /protein_id="ACD18451.1"
FT                   /translation="MTTLAARKRLSRSTQAMDSYRAPVKSRVTTIGAALVALIVIVAVM
FT                   RLAPGFRTWLAAPTGSDAAQLAGILLFDLSVPRILAALVAGGCLAVAGTLFQSLTRNPL
FT                   ASPDLLGITGGAQLGLLAAMLVPSLAGVASVPLLFACGLGAAACVAAAAGGWRATPLRL
FT                   VLAGSVCMLLFSALTTLILAFFEQSIVGVSLWASGSLYQPGAAGLKIAASWLVLPLIAL
FT                   PFVIRPLDPLALGDDAAAAAGVRVDATRLAAMVVAVGFASVAVSVAGPLSYVGLIAPNL
FT                   LRQMRGAKASRLAALVPLSALVGGALVLVTDSAVQALDLDATLSTGVAIAFVGTPLMLA
FT                   MIRSGAAWSGALHAGQERAVARAGTRFVRAIDARPWPLTASALVLLGVVLVCAGASFGP
FT                   TTIGAQRWLAAFDHRDELARMLLDLRLPRLICALLAGALLAASGVLMQSIVRNPLAGPE
FT                   VLGVTQGAGLATLAALVMWPLANHSTLAAASLAGGGITLALTLLLNRRHRYAPLAVALT
FT                   GIVIGTLWTTLSQWLITQQSVQPARFVVWLVGGTYGRSWGEVTTLLPWCVLALPVFALL
FT                   ARPLDLLALGDDQAASLGLPIGVLRPLVLTVATLAACAAVAAVGPVGFIGLMAPHLASM
FT                   LGARAHRTRLWLAAACGALVLVVADIAARTLLAPREIPAGVLTALIGAPYLLALLIVEA
FT                   RREKRGKR"
     atgacgacgc ttgccgcacg caaacgcctg agccgcagca cccaggcgat ggacagctat        60
     cgcgcgcccg tcaagagccg cgtcacgaca atcggcgccg cgctcgttgc gttgatcgtc       120
     atcgtggcgg tgatgcggct cgcgcccggc ttccgcacat ggctcgccgc gcccacaggc       180
     agcgacgccg cgcagctcgc cggcattctg ctgttcgacc tgagcgtgcc gcgcattctg       240
     gcggcactgg tggcgggcgg ctgcctcgcg gtggccggca ccttgtttca atcgctgacg       300
     cgtaaccctt tggcttcgcc cgatctgctc ggtatcaccg gcggcgcgca actcggcttg       360
     ctcgccgcga tgctggtgcc ctcgctcgcg ggcgtggcgt ccgtgccgct gctgttcgcg       420
     tgcggtctgg gcgccgccgc ctgcgtggcc gcggcggctg gcggctggcg cgcgacgccg       480
     ttgcggctcg tgctcgccgg cagcgtctgc atgctgctgt tctctgcgct gaccacgctg       540
     attctcgcgt tcttcgagca gagtatcgtc ggcgtgtcgt tgtgggcgag tggcagtctt       600
     tatcaacccg gcgcggcggg tttgaagatc gccgcgtcct ggctcgtgtt gccgctgatc       660
     gcgttgccct tcgtgattcg tccgctcgat ccgctcgcct tgggcgacga cgccgcggcg       720
     gcagccggcg ttcgcgtgga tgccacgcgc ctcgcggcga tggtggttgc ggtgggcttc       780
     gcgagcgtcg cggtgagtgt cgcgggaccg ctttcgtatg tcggcctgat cgcgccgaac       840
     ctgctgcgtc agatgcgggg tgcgaaagcg tcgcggttgg ccgcgctcgt gcccttgtcc       900
     gcgctggtcg gcggcgcgct ggtgctcgtc accgatagtg ccgtgcaggc gctcgatctc       960
     gacgcgacgc tttcgaccgg cgtggcgatt gccttcgtcg gcacgccgtt gatgctcgcg      1020
     atgatccgca gcggcgccgc atggtcgggc gcgttgcatg ccggtcagga gcgcgccgtc      1080
     gcgcgagcgg gcacgcgttt cgtgcgcgcg atcgatgcgc ggccgtggcc gctgacggcc      1140
     agcgcgttgg tgctgctcgg cgtcgtgctc gtgtgtgcgg gcgcgtcgtt cggtcccacc      1200
     acgatcggtg cgcagcgctg gctcgccgcg ttcgatcacc gcgacgaact cgcgcggatg      1260
     ttgctcgacc tgcgcttgcc gcgcctcatc tgcgcgttgc tcgcgggcgc gctgctcgcc      1320
     gcgagcgggg tgctgatgca aagcatcgtg cgcaatccgc tcgccggacc tgaagtactg      1380
     ggcgtgaccc agggcgcggg cctcgcgacg ctcgccgcgc tcgtgatgtg gccgcttgcg      1440
     aaccactcga cactggccgc cgcttcgctc gcgggtggcg gcatcacgct ggctctgacg      1500
     ctcctgctga atcgccggca tcgctatgcg ccgctcgcgg tcgcgctgac gggcatcgtc      1560
     atcggcacgc tgtggacgac gctgtcgcaa tggctgatca cgcagcaaag cgtgcagccc      1620
     gcgcgcttcg tcgtgtggct ggtgggcggc acatatgggc gcagctgggg cgaagtgacg      1680
     acgttgctgc cgtggtgcgt gctggccttg ccggttttcg cgctactcgc gcggccgctc      1740
     gatctgcttg cattgggcga cgaccaggcg gcctcgctgg gcttgccgat cggcgtgttg      1800
     cgtccgctgg tgctgacggt ggcgacgctc gccgcgtgcg ccgcggtggc cgcggtggga      1860
     ccggtgggct ttatcggttt gatggcgccg catctggcgt cgatgctcgg tgcgcgggct      1920
     catcgcacgc gcttgtggct ggcggcggcg tgcggcgcgc tggtgctggt cgtggccgat      1980
     atcgcggcgc gcacgctgct ggcgccgcgc gaaattcccg ccggcgtcct gaccgcgttg      2040
     atcggcgcgc cttatctgct cgcgctgctg atcgtggagg ctcggcgcga gaagcggggc      2100
     aaacggtga                                                              2109
//

If you have problems or comments...

PBIL Back to PBIL home page