(data stored in ACNUC7421 zone)

EMBL: CP001053.PE78

CP001053.PE78        Location/Qualifiers
FT   CDS_pept        86828..87856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4069"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   bxe:Bxe_B0523 ABC Fe3+-hydroxamate transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4069"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18453"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED2"
FT                   /protein_id="ACD18453.1"
FT                   /translation="MNAVMAATLFSNAYAFAQGNGTAASPTQSNTAQAQPQTCKPLADN
FT                   PIVSQASPSLPAQPKRIVVLEFMFAEDLAAVGITPVGMADPEYYPVWIGYDNARLASVP
FT                   DIGTRQEPSLEAIAAAKPDLILGVGLRHAPIFAALERIAPTVLFKYGPNFTEDGARVTQ
FT                   LDWGRKILRTIGCLTGREEAARAVEAKVDAGFARDAQRLAEAGRRGEQVAWLQELGLPD
FT                   RYWAFTGNSTAAGVAHALGLNLWPAEATREGTAYVSSEDLLKKPKLTVLFVSATEKDVP
FT                   LATKLDSPIWRFVPARSAGRVGLVERNIWGFGGPMSALRLANTMTDTLLSLPAPGVNKQ
FT                   ER"
     atgaatgctg tgatggcggc cacgctgttt tccaacgcgt atgcgtttgc acaaggcaac        60
     ggcactgcgg ccagtccaac tcaatcaaac accgcacaag cgcagccgca aacctgcaaa       120
     ccgctcgccg acaacccaat cgtctcgcaa gccagtccgt cgttgcccgc gcaaccgaag       180
     cgcatcgttg tcctcgaatt catgttcgcc gaagatctgg cggcagtcgg catcacgccg       240
     gtcggcatgg ccgatcccga gtactacccg gtgtggatcg gttacgacaa tgcgcgtctt       300
     gcgtcggtgc ccgacatcgg cacgcggcag gagccgagtc tggaggcgat tgcggcggcc       360
     aaacccgatc tgatcctcgg cgtgggattg cgccatgcgc cgatcttcgc ggcgttggaa       420
     cgcatcgcgc cgaccgtgct gttcaaatac ggtccgaact ttaccgaaga cggcgcgcgc       480
     gtcacgcaac tcgattgggg ccgcaagatt ctgcgcacta tcggctgtct gacgggacgt       540
     gaggaggcgg cgcgcgcagt cgaagccaag gtcgacgcag gtttcgcccg cgacgcgcag       600
     cgtctcgccg aagcgggccg tcgcggcgaa caggtagcgt ggttgcagga gttgggcttg       660
     ccggaccgct actgggcgtt caccggcaac agcacggcag cgggtgtcgc gcatgcgctc       720
     gggctgaacc tgtggcccgc tgaagcgacg cgcgaaggca ccgcgtacgt gagttcggaa       780
     gatctattga agaagccgaa gctgaccgtg ctgttcgtca gtgcgactga aaaggatgtc       840
     ccgctcgcca ccaaactcga ctcaccgatc tggcgtttcg tgccggctcg cagcgcgggg       900
     cgcgttgggc ttgtcgagcg gaatatctgg ggttttggtg gaccgatgtc agcgctacga       960
     cttgccaata cgatgaccga tacgttgttg tcgttgccgg cgccgggcgt caacaagcaa      1020
     gaacgctaa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page