(data stored in ACNUC7421 zone)

EMBL: CP001053.PE8

CP001053.PE8         Location/Qualifiers
FT   CDS_pept        7569..7850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3997"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3997"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18383"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE62"
FT                   /protein_id="ACD18383.1"
FT                   /translation="MNTLMIKDLSITEQLDSRAMSAVRGGTGYYPSSSYFNFMPVYAPN
FT                   NSKTVDATQLINTTMNIQNANGNNAAFVAGISSTIDPHVTASNNINVH"
     atgaacacgc tgatgatcaa agacctgtcc atcaccgaac aactcgacag ccgtgccatg        60
     agcgccgtgc gcggcggtac cggatactat ccgtcctcgt cgtacttcaa cttcatgccg       120
     gtgtacgcgc cgaacaacag caagaccgtc gacgccaccc aactgatcaa cacgacgatg       180
     aacatccaga acgccaacgg caacaacgca gcgttcgttg ccggcatctc gagcacgatc       240
     gatccgcacg tgaccgcgag caacaacatc aacgtgcact aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page