(data stored in ACNUC7421 zone)

EMBL: CP001053.PE81

CP001053.PE81        Location/Qualifiers
FT   CDS_pept        90294..99986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4072"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: non-ribosomal peptide synthase; amino acid
FT                   adenylation domain protein; PFAM: AMP-dependent synthetase
FT                   and ligase; condensation domain protein;
FT                   phosphopantetheine-binding; KEGG: bxe:Bxe_B0525
FT                   non-ribosomal peptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4072"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18456"
FT                   /db_xref="GOA:B2TED5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED5"
FT                   /protein_id="ACD18456.1"
FT                   /translation="MTSFPIALHHQIHAMARIDPDAPALASFTPHTVRLTRGELDSRAA
FT                   RLAAQLRAAGVTTEVRVGVCVARSCDLFVALLAVLKAGGVFVALDPRHPAARLDWVARD
FT                   AGLMHGIVDGSADAAMRARFTQCFDVASAAATDAAAPRFDGDEANTPVHPRAAAYMIYT
FT                   SGSTGTPKAVAVEHGPLAAHGEALADSLPIGANDRVLHFASVNFDVSIEAWLVPLAVGG
FT                   SVVISDPPPFAPETTHAFMLREGITNTTLPPAYVREFANVCERLGVPPSLRTLLFGGEA
FT                   MSQDSFDEIRRVFPAVRLVNGYGPTEAVISPMLWPVDPGMTPLLDDGNGFASLPIGWPI
FT                   GRRVARIDGAARQGESGELLLGGVCLARGYHGRAALTAERFLPDASGEPGERIYRTGDL
FT                   ARERVDGSFDYLGRIDDQVQVRGVRVEPGEIAACLLTHPAVADAGVLAETAGGRTQLIA
FT                   CFVLHEELDDAALQTHLAAHLPQAWMPHRLVRFERLPYTLNGKLDRAALRDFIAKMPAV
FT                   VHVNHVAPRTATETRLAALWQTLLSDPAPIGCADRFFARGGDSLAAMQLQAAIRIEWRV
FT                   NLRLDALFDDQPLEALARLIDDSETETSMGSHAITVVQTTDAPFVDRAASFAQQRFWVL
FT                   AQTQDAGAAYHVAVQWDVQGALEIGTLQRALDCLIARHQAWRTTLVESDDGIVIQRIHA
FT                   RLPVPVVQFDLRACDEAERTSRLVELTEQQVGTAFDLSKGPLVRAALVTLTNDTQRFLL
FT                   TTHHSISDGWSSRCAFDELRAAYAAFAVGSEPQLPTLAIQYADYAQWQRDWLAAGEADR
FT                   QLAYWRDALRDAPEALALPLDRPRSPEHDYRGGRVALRLPIALSEAVRETARRVQASPF
FT                   TVLLAAFDAWLYRLTGTSDIVVAAPIAHRQRAETAPLVGLFLNTLALRARVAPDQSFAA
FT                   LLDGVRRSAFDAFAHQDVPFDQVLDAVKPPVRRGDAWLKVKFAQQFDLELSAELPGASV
FT                   RMSPGLDLAARFDYALDFTDDSRGIELVVAYALDGIDEATAHAWLHSYAALVADAVRDP
FT                   QRAIAELDCADSADYRAARRGREFQPAADNVLALFARHARKTPDRVALADAETQLTYAE
FT                   VDAASDRIAFALRQRGVGAEQPVAVCIERSVRFAVALIGVMKSGAYVVPLDPAAPRERL
FT                   TASVEACGARWILTANQTQAMAAVGAASTLDFDALTQASSPASVEEATASPATPLANQA
FT                   AYLIFTSGSTGTPKGVVISHGALADYVEGMLDELAFAADASMAMVSTVAADLGHTTLFG
FT                   ALCSGRTLHLLPAQCAFDPDRFAHEMRTRNVGILKIVPSHLHALLDAQHPADVLPAHAL
FT                   VMGGETLPWSLVERIAALNPTCRVINHYGPTEATVGALTCDTSASAQAALRTLSTRSAQ
FT                   AVPLGLPLPNAYACVLDSHGASVPPGAIGELYLGGPGLARGYLNRAAATAERFVPNPFA
FT                   PGERLYRTGDRVRLRADRRLDSLGRLDDQVKIRGYRVEPGEVSAALRALDGIVQAETLA
FT                   VEHDGRLRLASFVALASDARFDEAALRATLSARLPDYMVPAVLQHVAALPVTANGKVDR
FT                   AALRALATAPAPAVAAGDAPQNATEEALAAVWKDVLKAERVGRDDNFFELGGDSILVLQ
FT                   VIARSRKRGVRFTPKQLFDAPTLAQLARVATTVDVTAQAAPAASKSQPVPAKAEHSATL
FT                   TPAQLRFFALDIPRRGHWNQSIELDTQVPFDFDAFARAFETLLTYHEIFRQRFTPVGAQ
FT                   GEWRLELAERAFETLPLAASSARDEADALAQFDALQSTLDLTHGPLVCALAALLPDGTT
FT                   KLYLAIHHIIVDGVTWRVLLDDLDAAYRAACERRSVRLASTGTSAQEWAARLARAALDI
FT                   KNSPFAAELPYWAALAAPYDDLPLDRPQAKATNADAQSVIQTIDADLTRAALTEANAAY
FT                   RTQMIELLIAALAQSLDMPVCRIELEGHGREAVFDDVDVSRTPGWLTSHYPVQFTLEST
FT                   PAATLGAVKDTLRAVPNKGLGFGVLCHYGDPATRATLAAVPRPHVTFNYLGQFDAPREA
FT                   ALVPRFGGAGRERDPAGPIGNALAIHAYIDGDATRTLKIHWVYGATQFERATVEAIAQR
FT                   FESALAALTAACAARLAQRGGGATPGDYPLARMGGLTQAALERLPLDLRSIDDIYPLSP
FT                   MQHGILFHSLFAPEQSTYVNQLVATLIDPDVERLRAAFEAAVPRHDILRTSFTPDEATP
FT                   MQIVHRQARMPVDILDWRERGAHAHDAFEAWLRADRARGFDLTSPPLMRVALIRITDDA
FT                   WRLVWTRHHLLLDGWSTARFFADVLRDYIEPPRPQPFASPAKTRYRDFIAWLAARDTDS
FT                   ERAFWLQRLASLDEPTLVAERESASGRESQHLTRRETIDAATTARLTETARRLKVTVNT
FT                   MVQGAWALALQRMTHHTAVAFGATVAGRPDALPDVDTVLGLFINTLPVITAPLPQRRAS
FT                   EWLHDLQRDNAAAAEHAHTPLYEIQQWAGQGGGALFDTLVVFENYPVDEAWQGRDERAL
FT                   KLRELRNIEATDFALTLVIEAGATLTIDYGYDAAQLDEARVAALHRAFAACLAGLIADA
FT                   DAPLGTISISTADDLAALARFNSTEQVWPGTQQQALHRQFEQKALASPEAIALEFVDAL
FT                   GHTQQMSYGELDANADRVAASLIQAGVRADTAVALCVERSFDMVVALIGVLKAGAAYLP
FT                   IDPDYPADRIAYLLDDAKPAVVLTQPHLLERVMAAVDRTRVSILAVDALRGADFTLSAP
FT                   VPVAPDQLAYLIYTSGSTGKPKGAGNTHRALANRIAWMQDVYRLDANDVVLHKTPFGFD
FT                   VSVWEFVWPLAIGAKLAIAAPGDHRDPARLVAAIETHRVTTLHFVPSMLAAFAAHLEDF
FT                   RAAARCASVERIVASGEALAPELVARVAGQLPHARLYNLYGPTEAAIDVSHWTCDARDA
FT                   DAASVPIGHPIANLQLQVLDAALQPLPQGAIGELYLGGVGLARGYLGRAALTAERFVPD
FT                   PFSRGARLYRTGDLARRRADGALDYLGRMDTQVKLRGQRIEPGEIEALLRATPGVHDAV
FT                   VIVRDEQLIGYVACGADNALDTQALLDDLRAQLPSYMVPSYLIAMDALPVTPNGKCDRH
FT                   ALPVPVRGTASESATCVAATETERELAEIWKRVLRVDTIGRDDDFFALGGHSLLATQAN
FT                   AQANLHWTLILPLRTLFDERTLQRCAAAIDRALAERDAHGAGDTASAIDALLDEFELQ"
     atgacgagct tcccgattgc gttgcaccac cagatccacg cgatggcgcg catcgatccc        60
     gatgcgcccg cgctagcgtc ttttacgcca cataccgtgc ggctgacgcg cggcgaactg       120
     gatagccgcg cagcgcgcct tgccgcgcaa ctgcgcgcgg cgggtgtgac gactgaagtg       180
     cgcgtgggtg tttgcgtcgc gaggtcgtgc gatctgttcg tcgcgttgct cgcagtattg       240
     aaggcgggcg gcgtattcgt cgcgcttgat ccgcgtcatc cggcggcacg cctcgattgg       300
     gtcgcgcggg atgcggggct catgcacggc atcgtcgatg gttccgccga tgcggcgatg       360
     cgcgcgcgtt tcacgcaatg cttcgatgtc gcaagcgctg ctgcgacaga tgcagcagcg       420
     ccgcgtttcg acggcgatga agcaaacacg ccggtgcatc cgcgtgcggc ggcctacatg       480
     atctacacgt cgggttcgac gggcacgccc aaagccgttg ccgttgaaca cggaccgctt       540
     gccgcgcacg gtgaagcgct ggccgactcg ttgccgatcg gtgcaaatga ccgcgtgctg       600
     catttcgcat cggtcaattt cgacgtttca atcgaagcat ggttagtacc gctagccgtc       660
     ggcggcagcg tggtgatcag cgacccgccg ccgttcgcgc cggaaaccac gcatgcgttc       720
     atgctgcgcg aaggcatcac caatacgaca ctgccgcccg cttatgtgcg cgagttcgcg       780
     aacgtttgcg agcgcctcgg cgtgccgcct tcgttgcgca cgctgctgtt cggcggcgaa       840
     gcgatgtcgc aagacagttt cgacgagatt cgccgcgtgt tccccgcagt gcgtctggtc       900
     aacggctacg gtccgaccga ggcggtgatt tcgccgatgc tgtggcccgt cgatccgggc       960
     atgacaccgc tgctcgacga cggcaacggc ttcgcatcgc tgccgatcgg ttggccaatt      1020
     gggcggcgcg tggcgcgcat cgacggcgcg gcgcgacagg gtgaaagcgg tgaactgctg      1080
     ctaggcggcg tgtgtctcgc gcgtggctac catggccgcg ctgcactcac ggcggaacgt      1140
     tttctgccgg acgcgagcgg cgaaccgggc gagcgcattt accgcaccgg cgacctcgcg      1200
     cgcgaacgcg tggacggttc gttcgactat ctcggccgca tcgacgatca ggttcaggtg      1260
     cgcggcgtgc gcgtcgagcc tggcgaaatc gctgcttgtc tgctgacgca tccggcggtg      1320
     gccgatgcgg gtgtgctggc tgaaacggcc ggcggccgaa cgcaattgat cgcttgcttc      1380
     gtgctgcacg aggaactcga cgatgccgcg ctgcaaacgc atctcgccgc gcatctgccg      1440
     caggcgtgga tgccgcatcg gttggtgcgc ttcgagcgcc tgccgtacac gctgaacggc      1500
     aagctcgatc gtgccgcgtt gcgcgacttc attgccaaga tgccggcggt tgtccatgtg      1560
     aatcatgtgg cgcctcgaac cgccacggaa acgcgcctcg ccgcgctttg gcaaaccttg      1620
     ctgagcgacc cggcgccgat cggttgcgcc gaccgtttct tcgcacgcgg tggcgattcg      1680
     cttgcagcga tgcaattgca ggcagcgatc cgtatcgaat ggcgcgtgaa tttgcggctc      1740
     gacgcattgt tcgacgatca accgctcgaa gcactagcgc gtttgatcga tgacagcgag      1800
     accgaaacgt cgatgggttc gcatgccatc accgtagtgc agacgaccga cgcgccgttc      1860
     gtcgaccgtg ccgcctcgtt cgcgcagcag cgtttctggg tgctcgcaca aacgcaggac      1920
     gccggcgcgg cctatcacgt cgccgtgcaa tgggacgtgc agggcgcgct agagataggc      1980
     acactgcaac gcgcgcttga ctgtctgatc gcccgtcatc aggcgtggcg aaccacgctg      2040
     gtcgagtccg acgacggcat cgtcatccag cgcattcatg cccgcttgcc ggtgccggtc      2100
     gtgcaattcg atttgcgggc ttgcgacgag gccgaacgca cgtcacgttt ggtggagttg      2160
     accgagcagc aagtcggcac ggctttcgat ctgtctaaag gtccgctcgt gcgcgccgcg      2220
     ctcgtcacgc tcaccaacga cacgcagcgc tttctgttga ccacgcatca ttcgatcagc      2280
     gacggctgga gttcgcgctg cgccttcgac gaactgcgcg ccgcctacgc agccttcgct      2340
     gtgggaagcg agccgcaatt gcccacgttg gccatccagt atgccgacta tgcgcaatgg      2400
     caacgcgact ggctcgcagc cggcgaagca gacaggcaac tggcttactg gcgcgacgca      2460
     ctgcgcgatg cacccgaagc gctagccttg ccgctcgacc gcccacgctc accggaacac      2520
     gactatcgcg gcggccgggt tgcgctgcgg ttgcctattg cgctttccga ggccgtgcgc      2580
     gaaactgcgc gacgcgtgca ggcgtcgccg ttcactgtac tgctcgccgc cttcgacgcc      2640
     tggctttacc ggttgaccgg cacgagcgat atagtcgtgg ccgcgccgat cgcgcatcgg      2700
     caacgcgcgg agaccgcgcc gttggtgggc cttttcctca acacgcttgc gctgcgcgcg      2760
     cgtgtcgcgc cggaccaatc gttcgccgcg ctgctcgatg gcgtgcgccg ctccgcattc      2820
     gacgcgttcg cgcatcagga tgtgccgttc gatcaggtgc tcgacgccgt taagccgccg      2880
     gtgcggcgcg gcgatgcgtg gctcaaggtg aagttcgcgc agcagttcga tctggagttg      2940
     tcggctgaat tgccgggcgc ttcggtgcgc atgtcgccgg gtctggatct tgccgcccgc      3000
     ttcgactatg cactcgattt caccgacgat tcgcgcggca tcgaactggt cgtcgcttat      3060
     gcgctcgacg gtatcgatga agcgaccgct cacgcgtggc tgcacagcta cgccgcgctc      3120
     gtcgccgatg ccgtgcgcga tccgcagcgc gcgattgccg aactggattg cgcggatagc      3180
     gccgactatc gcgctgcacg gcgtggccgt gaattccagc cggcggccga caacgtgctc      3240
     gcgctgttcg cgcggcacgc acgtaagacg ccggatcgcg tggcgctcgc ggatgccgag      3300
     acgcaactca cgtacgccga agtcgatgcg gcgtccgacc gtatcgcatt tgctttgcgt      3360
     caacgtgggg tcggcgcgga gcagccggtg gcggtatgta tcgagcggtc ggtgcgcttt      3420
     gccgtcgcgc tgatcggcgt gatgaagtcc ggtgcgtacg tcgtgccgct cgatcctgcc      3480
     gcgccgcgtg agcgtctgac tgcttccgtc gaagcgtgtg gcgcgcgatg gattttgacg      3540
     gcgaatcaaa cgcaggctat ggccgcggta ggcgcggcaa gcacgctcga tttcgatgcg      3600
     ctcacgcaag cgtcatcgcc ggcgagcgtg gaagaggcaa ccgcatcacc cgcgacccct      3660
     ttggcgaacc aggccgccta cctgatcttc acctccggct cgaccggcac gccgaaaggc      3720
     gtcgtcatct cgcacggagc gctggccgac tacgtcgaag gcatgctcga cgaactcgca      3780
     ttcgccgccg atgcatccat ggcaatggtc tccaccgtcg ccgccgatct cggccacacc      3840
     acgttattcg gtgcgctctg ttcgggccgc acgctgcatc tattgcccgc gcaatgcgca      3900
     ttcgatcccg atcgattcgc ccacgaaatg cgcacgcgca acgtcggcat tctcaagatc      3960
     gtgccgagcc acttgcatgc actgctcgac gcgcagcatc cggccgacgt gctgcccgcg      4020
     catgcgcttg tgatgggagg cgaaacgttg ccgtggtcgc tggtcgagcg gatcgcggca      4080
     ctgaatccga cttgccgcgt catcaatcac tatggtccga ctgaagcaac ggtaggcgca      4140
     ttgacatgcg acacatccgc gtccgctcaa gccgcgttgc gtacgctgag cacgcgtagc      4200
     gcacaagcgg tgccgctcgg tctgccgttg ccgaacgcat atgcttgcgt gctcgacagc      4260
     catggcgcga gcgtgccgcc gggcgcgatc ggcgagttgt atctcggcgg accaggtttg      4320
     gcgcgcggtt atctgaatcg cgctgcggcg accgcagagc gtttcgtgcc gaatccgttt      4380
     gcgcctggcg agcgtctcta tcgaacgggc gatcgcgtga gattgcgtgc cgaccgccgg      4440
     ctggattctc tgggccgcct cgacgatcag gtcaagattc gcggctaccg cgtcgaacct      4500
     ggcgaagtca gtgcggcact gcgtgcgctc gacggtatcg ttcaggccga aacgctggcc      4560
     gtagagcacg atgggcgctt gcgtctggcc tcgttcgtcg ccttggcgag cgacgcccgc      4620
     ttcgacgaag ccgcattgcg cgcgacgttg agcgcgcgtc tgccggacta catggtgccg      4680
     gcggtattgc agcatgtcgc tgcgttgccg gtgaccgcca acggcaaggt ggatcgcgcg      4740
     gcattgcggg cgctggcgac tgcaccggcg ccagcggtag ccgcgggcga cgcgccgcaa      4800
     aacgcaacag aagaagcgct cgccgcggta tggaaagacg tgctcaaagc agaacgcgtg      4860
     ggccgcgatg acaacttctt cgaactgggc ggcgactcga ttctggtgtt gcaggtaatc      4920
     gcccgttcgc gcaagcgcgg tgtgcgtttt acaccgaagc aactgttcga tgcgccaacg      4980
     ctcgcgcaac tcgcacgtgt cgcaacgaca gtggacgtca ccgcacaggc cgcgccggct      5040
     gcatcgaagt cacagcctgt accagccaaa gccgagcact ccgccacgct cacgcccgca      5100
     caactgcgtt tcttcgcact ggatattccg cgacgtggtc actggaatca atccatcgag      5160
     ctcgacacgc aagtaccgtt cgacttcgat gcgttcgcgc gcgcattcga aacgctgctg      5220
     acatatcatg agatttttcg tcagcgtttc acgccagtcg gtgcgcaagg cgaatggcgt      5280
     ctagagctag ccgagcgcgc attcgaaaca ctgccgctcg ccgcgagttc cgcgcgcgac      5340
     gaagccgatg cgctagccca attcgacgcc ttgcagagca cgctcgatct gacgcacggc      5400
     ccgctcgtct gcgcgctggc cgcgctgctg ccggacggca ccacgaagct ctatctggcg      5460
     atccaccaca tcatcgtcga cggcgtgacg tggcgtgtgt tgctcgatga cctcgacgcc      5520
     gcctatcgcg ccgcttgcga gcgtcgcagc gtgcgtcttg cgtcgacggg aacgagtgcg      5580
     caggaatggg cggcacggct cgcacgcgca gcactcgaca tcaagaactc gccgtttgcc      5640
     gccgagctac cgtactgggc cgcgctcgcc gcgccctacg acgatctgcc gctcgaccgt      5700
     ccgcaagcca aggcgaccaa cgccgacgcg caatccgtga tccagaccat cgacgccgat      5760
     ctgacacgcg ccgcattgac ggaagcgaac gccgcgtacc gcacgcagat gatcgaactg      5820
     ctgatcgcgg cgctggcgca gtcgcttgac atgcctgttt gccgtatcga actcgaaggc      5880
     cacggccgtg aggctgtgtt cgacgatgtc gatgtcagcc gcacgcctgg ctggctcacg      5940
     agtcattacc cggtgcagtt cacgcttgaa agcacgccgg cggccacgct cggcgcagtc      6000
     aaggacacgc tgcgcgcggt gccgaacaag ggcctcggtt ttggcgtgct gtgccactac      6060
     ggcgacccgg cgacgcgtgc gacgctcgcc gccgtgccgc gcccgcatgt gacgttcaac      6120
     tatctcggcc agttcgacgc accgcgcgaa gcggcgctcg tgccgcgttt cggcggcgcg      6180
     ggccgcgaac gcgatccggc gggaccgatc ggcaatgcgt tggcgattca cgcctatatc      6240
     gacggcgacg ccacacgaac gctcaaaatc cattgggtct acggagcgac gcaattcgag      6300
     cgtgctaccg tggaggccat cgcgcagcgc tttgaaagcg cgctcgcggc tttgacggcg      6360
     gcatgcgcgg cgcgtctcgc gcaacgcggc ggtggcgcga cgcctggcga ctatccgctc      6420
     gcgcgcatgg gcggcttgac gcaggccgcg ctcgaacgct tgccgctcga tttgcgcagc      6480
     atcgacgata tctatccgct ttcgccgatg cagcacggca ttctgttcca ctcgttgttc      6540
     gcgcccgagc agtccaccta tgtgaatcaa ctggtcgcga ccttgatcga tccggacgtg      6600
     gagcgtctgc gcgcggcgtt cgaagccgcc gtgccacgcc acgacattct gcgcaccagc      6660
     ttcacgccgg acgaagcgac gccgatgcag atcgtgcatc gccaggcgcg tatgccggtc      6720
     gacattctcg attggcgcga gcgtggcgcg cacgcgcatg atgcattcga agcctggctc      6780
     cgcgccgacc gtgcgcgcgg tttcgatctg acgtcgccgc cgctgatgcg cgtcgcactg      6840
     atccgcatca cggatgacgc ctggcgtctc gtctggacgc gtcaccactt gctgctcgac      6900
     ggctggagca cggcgcgttt cttcgccgac gtgctgcgcg actatatcga gccgccgcgt      6960
     ccgcaaccct tcgcgtcgcc cgcgaaaacg cgctatcgcg acttcatcgc gtggctggcc      7020
     gcgcgcgaca cggacagtga acgcgctttc tggctgcagc gtctcgcgtc gctcgacgaa      7080
     ccgacgctgg ttgccgagcg cgagtccgcg agcggccggg aatcgcagca tctcacgcgg      7140
     cgtgaaacga tcgacgcagc gaccacggcg cgacttaccg aaaccgcgcg ccgtctgaaa      7200
     gtcacggtca acacgatggt gcagggcgcg tgggcgctag cactgcagcg catgacgcat      7260
     cacacggccg tcgcgttcgg cgcgaccgtc gccggccgtc cagatgcgtt gccggacgtc      7320
     gataccgtgc tgggtctttt catcaacacg ctgccggtga ttacggcgcc gttgccgcaa      7380
     cgccgtgcat cggaatggct gcacgatttg cagcgagaca acgccgcggc cgcggagcac      7440
     gcgcatacgc cgctctatga aatccagcaa tgggcgggac aaggtggcgg cgcgctgttc      7500
     gacacgctgg tcgtgttcga aaactatccc gtggacgaag catggcaagg ccgcgacgag      7560
     cgcgcgctca agctgcgtga attgcgcaat atcgaagcga ccgacttcgc gctcacgctc      7620
     gtgatcgaag cgggcgcgac gctcacgatc gactacggct acgacgccgc gcaactcgat      7680
     gaagcgcgcg tcgccgcatt gcatcgcgca tttgccgcgt gcctcgcggg gttgatcgcc      7740
     gatgcggatg caccgctcgg cacgatttcg atttccaccg ccgacgatct ggccgcgctg      7800
     gcgcgtttca actcgaccga gcaagtgtgg ccaggcacgc agcagcaggc gctgcatcgc      7860
     cagttcgaac agaaggcatt ggcgtcgcct gaggcgattg cgcttgaatt tgtcgatgcg      7920
     ctagggcaca cgcagcagat gagctacggc gaactggatg cgaatgccga tcgcgtcgcc      7980
     gcctcgctta tccaagccgg cgtgcgcgcg gacacggcag tggcgctgtg tgtcgagcgc      8040
     tcgttcgaca tggtcgtggc gctgatcggc gtgctcaaag cgggcgcggc ctacttgccg      8100
     atcgatcccg actatccggc ggaccgcatc gcgtatctgc tcgacgacgc gaaacccgca      8160
     gttgtcctga cgcagccgca tctgctggaa cgtgtcatgg cagcggtcga cagaacacgc      8220
     gtgagcatcc tcgccgtcga cgcactacgc ggcgccgact ttacgctcag cgctcccgtg      8280
     ccggtcgcgc ccgatcaact ggcctacctg atctacacgt ccggttccac aggcaagccc      8340
     aaaggcgctg gcaatacgca tcgcgcgctg gcgaaccgca ttgcgtggat gcaggacgtg      8400
     tatcgcctcg acgccaacga cgtcgtgttg cacaagacgc cgttcggttt cgacgtgtcg      8460
     gtttgggagt tcgtgtggcc actcgccatc ggcgcgaagc tcgcaatcgc ggcgccgggc      8520
     gaccatcgcg atccggcgcg actggtcgca gccatcgaaa cgcatcgcgt cacgacgctg      8580
     catttcgttc cgtcgatgct cgcggccttc gccgcgcatc tggaagactt tcgtgcggcg      8640
     gcgcgttgtg cgagcgtcga gcgaatcgtc gccagcggcg aggcgcttgc gccggaactg      8700
     gtggcgcgcg tcgccggaca attgccgcac gcgcggctct acaacctcta cggcccgacg      8760
     gaagccgcca tcgacgtttc gcattggacg tgcgacgcgc gcgatgccga cgcggcatcc      8820
     gtgccgatcg gtcacccgat tgccaacctg caattgcaag tgctcgacgc ggcgttgcaa      8880
     ccgctgccgc aaggcgcgat cggcgaactg tacctgggcg gcgtgggcct ggcgcgcggc      8940
     tacctcggcc gtgccgcgct gacggcggaa cgcttcgttc ccgatccgtt ctcgcgcggc      9000
     gcgcggctgt atcgaaccgg cgaccttgcg cgtcgtcgcg cggatggtgc gctcgactat      9060
     ctcggccgca tggatacgca agtgaaattg cgtggccagc ggatcgagcc cggcgaaatc      9120
     gaagcgctgc tgcgcgcgac gccgggcgtg cacgatgccg tggtgatcgt gcgtgacgag      9180
     caattgatcg gctacgtggc gtgcggtgcg gacaacgcac tcgatacaca ggcgctgctc      9240
     gacgatttgc gtgcgcaact gccgtcatac atggtgccgt catacctgat cgcgatggat      9300
     gctctgccgg tcacgccgaa cggaaaatgc gaccgtcacg cattgccggt tcccgtgcgt      9360
     ggcaccgctt cagaaagcgc tacatgcgtg gccgccaccg agacagagcg cgaacttgcc      9420
     gagatctgga aacgcgtgct gcgcgtcgac acgattggcc gcgacgacga cttcttcgcg      9480
     ctgggcggcc actcgttgct cgcgacgcaa gccaacgcgc aggcgaatct gcactggacg      9540
     ctgatcctgc cgctacgcac cctgttcgac gagcgcacgt tgcagcgctg cgccgccgcg      9600
     atcgaccgcg cgctcgccga gcgcgacgcg catggcgcag gcgataccgc tagcgcgatc      9660
     gatgcgctgc tcgacgaatt cgaactgcaa taa                                   9693
//

If you have problems or comments...

PBIL Back to PBIL home page