(data stored in ACNUC7421 zone)

EMBL: CP001053.PE84

CP001053.PE84        Location/Qualifiers
FT   CDS_pept        106597..108834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4075"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: bpm:BURPS1710b_2091 TonB-dependent siderophore
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4075"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18459"
FT                   /db_xref="GOA:B2TED8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED8"
FT                   /protein_id="ACD18459.1"
FT                   /translation="MEWATGTRRSATAVTASVAFYAAAAASAQAQQSAQQPAQSEGNAQ
FT                   QGARSGQPAATQPATLPSISVNGLAGNDGTVGLVARRSNTGTKTDTPLKEIPQTINVVT
FT                   AQQIEETGATSINEALRYIPGFSTYGADVRSDWYSVLRGFTPTVFVDGLQVPNTLNLAS
FT                   WRVDPFMIDSITVLRGPTSVLYGQGDPGAIIDVQSKLANGERIREVEMQLGDYARKQIA
FT                   FDVGDKVDQAGTLSYRFLGVGRDGNSQTGPNPEQRVALAPSVKWQPNAKTSLTVEASYL
FT                   QDWGDASNNFLPAQGTVLPNPNGKISPDLYTGDPEFSHYRKKQWSVGYQFEYKFDPVWT
FT                   FRQNTRLMHLSLDQGQVFGGGLDPADPTEASLLRYVGLYQLNYSRFDVDNQALARFGTG
FT                   PLDHTVLLGFEYNRQATTDSESMATGPSLNMYNPVYTPITNAIFSGPDAFPRTDTKSTM
FT                   NAFGVYAQDQIKWQRWVLTLGARQDWSNTTQNDIAGGSRLEQNDHAFSGRVGVVYLGDY
FT                   GLSPYISYSTSFNPLVGVKIVGGGIAEPTKGKQIEAGLRWQPAGKNLMLNAAVYQINQT
FT                   NVVTPDFGIDPTGGTSVQTGEVRSRGIELSGVGNVTRNFSVIAAYVYQDVKNIKAGDDT
FT                   LGKWPVDIPRPRQMASLWGDWTWHAGPLAGLGFGGGIRYQSGAAGAADNSLYVPSYTVY
FT                   DAAVHYETRNWRFAVNGQNIFNRRFVSGCQSVNTCFYGNPRTVIATARYDW"
     atggagtggg caacaggcac gcgccggagt gcaaccgccg ttacggcgag cgtggcgttt        60
     tatgcggcgg cagccgccag cgcgcaggcg caacagtcgg cgcaacagcc ggcgcaatcc       120
     gagggcaatg cacagcaagg agctcgtagc ggccaaccgg ctgcgacgca gcccgctacg       180
     ctgccctcga tcagcgtcaa cggcttggcc ggcaacgacg gcacggtggg cctggttgcc       240
     cgccgtagca acaccggcac caagaccgat accccgctga aggaaattcc gcagaccatc       300
     aacgtcgtca cggcgcagca gatcgaagag accggcgcaa ccagcatcaa cgaggcgctg       360
     cgctacattc cgggcttctc gacctatggc gcggacgtgc gctccgactg gtattcggtg       420
     ttgcgcggct tcacgccgac ggtgttcgtc gacggcctgc aggtgcccaa tacgctcaat       480
     ctcgcgagct ggcgtgtcga tccgttcatg atcgacagca tcaccgtgct gcgcggcccg       540
     acctcggtgc tgtacgggca gggcgatccg ggtgcgatca tcgacgtgca gagcaagctt       600
     gccaacggcg agcgtattcg cgaagtggaa atgcaactgg gcgactacgc gcgcaagcag       660
     atcgcattcg atgtgggcga caaggtcgat caggccggca cgctgtccta tcgtttcctc       720
     ggcgtgggac gcgatggcaa ttcgcagacc ggacccaatc cggagcaacg cgtggcattg       780
     gcgccctcgg tgaaatggca gccgaacgcg aagacttcgc tgacggtcga ggcgagctat       840
     ctgcaggatt ggggcgacgc gtcgaataac ttcctgccgg cgcagggcac ggtcttgccg       900
     aatccgaacg gcaagatttc gccggacctg tacacgggag atcccgagtt ctcgcactat       960
     cgcaagaagc agtggtcggt gggctatcag ttcgaataca agttcgatcc ggtgtggact      1020
     ttccggcaga acacgcgctt gatgcacctc tcgctcgatc aggggcaggt gttcggcgga      1080
     ggtctcgatc cggccgatcc gaccgaggcg tcgctgctgc gctatgtcgg tttgtatcag      1140
     ttgaactaca gccgcttcga tgtcgacaat caggcgctgg ctcgcttcgg caccggtccg      1200
     ctcgatcata cggtgctgct cggcttcgaa tacaaccggc aggcgactac cgatagcgaa      1260
     tcgatggcga ccggtccgag tctgaacatg tataacccgg tctatacgcc gatcaccaac      1320
     gcgatcttca gcggaccgga cgcgttcccg cgtaccgaca cgaagtcgac catgaacgcg      1380
     ttcggcgtgt atgcgcagga ccagatcaag tggcagcgct gggtgctgac gctcggcgca      1440
     cgccaggact ggagcaacac cacgcagaac gatatcgccg gtggcagccg tctcgagcag      1500
     aacgatcatg cattctccgg gcgtgtgggt gtcgtgtatc tcggcgatta cggattgtcg      1560
     ccgtacatca gctactcgac gtcgttcaat ccgctggttg gcgtgaagat cgtcggcggc      1620
     ggcattgccg agccgaccaa aggcaagcag atcgaagcgg gtttgcgctg gcagccggcc      1680
     ggcaagaacc tgatgctgaa cgccgcggtt tatcagatca atcagaccaa cgtcgtgacg      1740
     cctgatttcg gcatcgatcc gaccggcggc acgagcgtgc agaccggcga ggtgcgttca      1800
     cgcgggatcg agttgagcgg cgtgggcaat gtcacgcgca acttttcggt gatcgcagcg      1860
     tatgtgtacc aggacgtgaa gaacatcaag gccggcgacg atacgttggg caagtggccg      1920
     gtggatattc cgcggccgcg ccagatggcg tcgctgtggg gcgactggac atggcacgcc      1980
     gggccgctgg caggcctcgg cttcggtggg ggcattcgct atcagagtgg cgcggcgggc      2040
     gccgccgaca actcgctgta cgtgccgagc tacaccgtgt acgacgcggc ggttcactac      2100
     gaaacgcgca actggcgctt cgcggtgaac ggtcagaata ttttcaatcg ccggttcgtg      2160
     agcggttgcc agtccgtgaa tacctgtttt tacgggaatc cacgcacagt gatagcaact      2220
     gcaagatacg actggtaa                                                    2238
//

If you have problems or comments...

PBIL Back to PBIL home page