(data stored in ACNUC7421 zone)

EMBL: CP001053.PE87

CP001053.PE87        Location/Qualifiers
FT   CDS_pept        111631..112569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4078"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0530 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4078"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18462"
FT                   /db_xref="GOA:B2TEE1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE1"
FT                   /protein_id="ACD18462.1"
FT                   /translation="MSDILDGVTTFVRVVETGSFALAAERMNLTRSAVGKVIVRLEKRL
FT                   GVRLLNRTTRSQSLTEDGQAYYDRCVRALAELEAAEADLDSGRREPQGRLRVSVPQAFG
FT                   HYCVAPVLLGLARKHPQLKIDISITDRFVDVIEEGFDLVVRVGPLADSVSLAARKLGMQ
FT                   HASIGAAPAYLARHGTPRNVEELRGHAVIGYLRAGSAQPWDVVDVDGQIRRAQVQPQLG
FT                   FDDMKGIVDAALAGFGLAWLPSWLLTRYEKTGELVTVMENCFRPAQEIHLVWPKSRYLA
FT                   LKTRCAIDALVAEIPAMIGAPAPGAPRSRDA"
     atgagcgaca tcctcgatgg tgtgacgacg ttcgtgcgcg tggtcgaaac aggcagtttt        60
     gcgctcgcgg cggagcggat gaacctgacg cgctcggcgg tcggcaaagt gatcgtgcgg       120
     ttggagaagc gcctcggcgt gcgcctgctc aatcggacga cgcgcagcca gagcctcacc       180
     gaagacgggc aggcttacta cgaccgctgc gtgcgcgcgc tggccgagct cgaagccgcg       240
     gaggcggatc tcgactccgg ccgtcgcgag ccccaaggcc gtttgcgcgt gagcgtgccg       300
     caggcattcg gtcactactg cgtggcgccg gtgctgctcg gacttgcgcg caagcatccg       360
     caattgaaga tcgacatttc gattaccgat cgtttcgtcg acgtgatcga agagggtttc       420
     gatctcgtgg tgcgcgtggg cccgctggcc gacagcgtga gtctcgccgc gcgcaagctc       480
     ggcatgcagc atgcgagtat cggcgccgcg ccggcgtatc tggcgcgtca tggcacgcca       540
     cgcaacgtgg aggaattacg cggtcacgct gtgatcggct acttgcgagc aggatcggcg       600
     cagccgtggg atgtggtcga tgtcgacggc caaattcgcc gcgcgcaggt tcagccgcag       660
     ctcggtttcg acgacatgaa ggggatcgtg gatgccgctc tcgctggctt cggcctcgcg       720
     tggctgccga gttggctatt gacccgttat gagaaaacgg gcgagctggt gacagtgatg       780
     gagaattgtt tccggcctgc tcaggagatt catctggtgt ggccgaagag tcgctatctg       840
     gcgctgaaaa cgcgctgtgc gatcgatgcg ttggtcgcgg agattcccgc catgatcggg       900
     gcgcccgctc cgggcgcccc tcgttcacgc gatgcttag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page