(data stored in ACNUC7421 zone)

EMBL: CP001053.PE88

CP001053.PE88        Location/Qualifiers
FT   CDS_pept        complement(112566..114749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4079"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: bxe:Bxe_B0531 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4079"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18463"
FT                   /db_xref="GOA:B2TEE2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE2"
FT                   /protein_id="ACD18463.1"
FT                   /translation="MQKFFVAGRPAFVRGPRRTPSLLSAGLLASVGLTLSTLSTSGWAQ
FT                   VAASDAGTTLPAVSVSAAKDTTVAQADTISAGALGSRKQVDTPFSTHVVTSDEAQDLFA
FT                   TTANDLYKYDPAVSVISDNGVSENSMFTVRGMPIDTLNSVKVDGQTFPSWDTDLSLEPF
FT                   EQVELLKGLSGFMYGFGSPGGIVNYVLKRPTDTPYRSISVGYKSAGVFSEAVDLGGRFG
FT                   NDDRFGYRLNLANENGNTAEDHGHVRRQVASLAFDFRITPDLTWSADAFYQKRRTNGTL
FT                   FGLMFGGDAGGIPDASKVTHALTQPQNYYETEMASFGTGLDYRISENWHASIKYRFAKE
FT                   NRTNSDSFLFVTDPAGNYSNTLYAALTRYFYQNVDGMVQGHFNTGTIKHDVVVGAGFLT
FT                   QTSEYSNSTGWNEGYFLGNGNLYASTLLTNDEVSISSNLYRQQRTTQAAVYASDTVQLT
FT                   SRLAALVGVRYTQYQQHVYDPSGAVSSQYQADPVTPTFALMFKTDPYSTLYVSYVESLE
FT                   QGGAASNTNLNYPDTFGPLRSKQYEVGFKTDHAKWGANLALFRVDQGYNYTNVDNIFVQ
FT                   DGTKRYQGLDASGWLAVTSEWRVLGGVMWLDTKAMDVNDPTVEGKRIYGAPRFTVTGRI
FT                   EYNPSYLRPLTLAFGGKYVGNQAVDAQNTQFVPAYTTFDLSGRYETKIAGKDVTFRAGI
FT                   NNLFNRRYWTTAWGYYVAPSATRTAVASATLQF"
     atgcagaaat tctttgtcgc cggccgaccg gcgtttgtgc gcggcccacg ccgcactccc        60
     tcgctgttga gcgcgggcct tctggcaagt gtcggtttga cgctttccac gctgtcgact       120
     tcgggttggg cgcaggtcgc ggccagcgac gccggcacga cgctgccggc cgtgagcgtc       180
     tcggcggcaa aagacaccac tgtggcccag gccgacacca tcagcgcggg cgcgctgggt       240
     tcgcgcaagc aggtggacac gccgttctcg acccacgtcg tgacgagcga cgaggcgcag       300
     gacctgttcg cgacaaccgc caacgatctg tacaagtacg atccggcggt ctcggtgatc       360
     agcgacaacg gtgtcagcga aaactcgatg ttcaccgtgc gcggcatgcc gatcgacacg       420
     ctgaacagcg tcaaggtgga cggccagact ttcccctcgt gggataccga cctctcgctg       480
     gagccgttcg agcaggtcga attgctcaag ggcctgtcgg gcttcatgta cggcttcggc       540
     tcgccgggcg gcatcgtgaa ctacgtgttg aaacgcccca ccgacacgcc gtaccgcagc       600
     atctcggtcg gctacaagtc ggccggcgtg ttcagcgagg cggtggatct gggcggccgc       660
     ttcggcaatg acgatcgttt cggctaccgc ctgaacctcg ccaacgaaaa cggcaacacc       720
     gccgaagacc acggccacgt gcgccgccag gtcgcgtcgc tcgcgttcga cttccgcatc       780
     acgccggacc tgacgtggag cgccgacgcg ttttaccaga agcgcagaac caacggcacg       840
     ctgttcggcc tgatgttcgg tggcgacgcc ggcggcattc ccgacgcgag caaagtcacc       900
     cacgcgctca cgcaaccgca gaactactac gagaccgaga tggcctcgtt cggcacgggc       960
     ctggattacc gcatctccga aaactggcat gcgagcatca agtaccgctt cgccaaggag      1020
     aaccgcacta attcggacag cttcctgttc gtcaccgacc ccgcaggcaa ctactcgaac      1080
     acgctctatg cggccctcac gcgctacttc tatcagaacg tcgacggcat ggtgcaaggg      1140
     catttcaaca cgggcaccat caagcacgat gtggtggtgg gcgcaggctt tctgacgcaa      1200
     accagtgagt acagcaacag cacggggtgg aacgaaggct acttcctcgg caacggcaat      1260
     ctgtacgcca gcaccttgct gaccaacgac gaagtcagca tcagctcgaa cctgtaccgt      1320
     cagcagcgca ccacgcaagc cgccgtgtac gcgagcgaca ccgtgcaact tacgtcgcgt      1380
     ctggcggcgc tggtcggcgt gcgctatacg caataccagc agcacgtgta cgacccgagc      1440
     ggcgcggtgt cgtcgcaata ccaggcggac ccggtcacgc cgaccttcgc gctgatgttc      1500
     aagaccgatc cgtactccac gctgtacgtg agctacgtgg agtcgctgga acagggcggc      1560
     gcggcgtcga acaccaacct caactacccg gacacgttcg gcccgctgcg cagcaagcag      1620
     tacgaagtcg gcttcaaaac cgatcacgcg aagtggggcg ccaacctcgc gctgttccgc      1680
     gtcgatcagg gttacaacta cacgaacgtc gacaacatct tcgtgcagga cggcaccaag      1740
     cgctatcaag gcctcgacgc gagcggctgg cttgcggtca cgagcgaatg gcgcgtgctg      1800
     ggcggcgtga tgtggctcga cacgaaggcc atggacgtga acgatccgac cgtggaaggc      1860
     aagcgcatct acggcgcgcc gcgcttcacc gtgacgggcc ggatcgaata caacccgtcg      1920
     tatctgcgtc cgctgacgct ggcgttcggc ggcaagtatg tgggcaacca ggccgtcgac      1980
     gcgcagaaca cgcagttcgt gccggcttac accacgttcg atctgagcgg acggtatgag      2040
     acgaagatcg ccggcaagga cgtgacgttc cgcgcgggca tcaacaacct gttcaatcgc      2100
     cgttactgga cgacggcgtg gggctactac gtggcgccgt cggcgacgcg cactgccgtg      2160
     gccagcgcaa cgctgcagtt ctaa                                             2184
//

If you have problems or comments...

PBIL Back to PBIL home page