(data stored in ACNUC7421 zone)

EMBL: CP001053.PE97

CP001053.PE97        Location/Qualifiers
FT   CDS_pept        complement(126604..127098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4088"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18472"
FT                   /db_xref="InterPro:IPR021267"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF1"
FT                   /protein_id="ACD18472.1"
FT                   /translation="MLAVAAASLALVALAAPAYAALGAAPTYPVTASSTSAGAASQNSA
FT                   AVARFAASGSAASAAYTVSQTTLPSGTVVSEYIGAGNTVFALSWQGPTMPPLKTLLAAY
FT                   FPSYVQALTDAHATQGGGYGPAAVHQSALVVETGGHMGAFVGRAYLPQALPQGVSADDI
FT                   K"
     atgctcgcgg tggccgcggc gtcgctcgct ctcgtcgctc tggccgctcc ggcgtatgcc        60
     gcattgggcg ccgcgccgac ctatcccgtc acggccagca gcacgagtgc tggggcggcc       120
     agccagaata gcgcggcggt ggcgcgcttc gccgccagcg gcagtgcggc ctcggcggct       180
     tacaccgtga gccagacgac gctgccgtcg ggcactgtgg tgagcgagta catcggcgcg       240
     ggcaatacgg tgttcgcgtt gagctggcaa ggcccgacca tgccgccgct caaaacgctg       300
     ctcgccgctt acttcccgtc gtatgtccag gcgctcactg acgcccacgc cacgcaaggc       360
     ggcggctacg gacccgccgc cgtgcatcag tcggcgctgg tcgtggagac cggcggccat       420
     atgggcgctt tcgtgggacg cgcctattta ccgcaagcgc tgccgcaagg cgtgagcgct       480
     gacgatatca agtaa                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page