(data stored in ACNUC7421 zone)

EMBL: CP001069.PE10

CP001069.PE10        Location/Qualifiers
FT   CDS_pept        8263..9765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3770"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG: rso:RSp1671 RNA
FT                   polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3770"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28886"
FT                   /db_xref="GOA:B2UH35"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH35"
FT                   /protein_id="ACD28886.1"
FT                   /translation="MVKAALEMRAKQHLALTPRLQQSVKLLQLSATEFAQEMQEALASN
FT                   PFLEEVEQEAGAQPDATRANDLPGPADLDGSGTDHTPSEALPLETTTSAIETDPALATA
FT                   DEFPADFGTYYSHGGAHHGDGEDSDIGEWVHATPSLREHLHQELRSYRLSQRDCLLGQT
FT                   VIEALDDDGYLRQLLSELIPLAPVEPPPTEKEMQIALALVQSLDPPGVAARDLSECLRL
FT                   QIEARPADTEAEERIQEVAHDIVRSHLPRLAKREFTQMRRALGCTEDELRDACALIRML
FT                   DPRPGLRFSQAHAGYIVPDVIVAKIRGKWIAVTNPAVAPCARINKVYAELFAQTRGYHR
FT                   TPLAHQLQEARWLIRNAQQRFATIQRVAEAIVAHQKHFLEYGEVAMKPLVLRDVAEELG
FT                   LHESTISRATGNKYMATPRGIFEFKYFFSRQLATDTGGACSAASVRALLKEMIEAEDAD
FT                   APLSDVSLAKMLAEQGVIVARRTVAKYRGLMRIAPAEMRRQV"
     atggtcaagg ccgctctgga aatgcgtgcg aagcagcatc tcgcgctgac gccgcggctg        60
     cagcagtccg tcaagctgct gcagttatcc gcaaccgaat ttgcgcagga aatgcaagaa       120
     gcgctcgcaa gcaacccgtt cctggaggag gtcgagcaag aagccggtgc gcagccggat       180
     gcgacccgtg cgaacgacct gcccggcccg gcagacctgg atggcagcgg caccgaccac       240
     acgccgtccg aagcattgcc gctggaaacc accacgagcg ccatcgagac cgacccggcg       300
     cttgccacag cagatgagtt tcctgccgat ttcggcacgt actacagcca tggcggcgca       360
     caccatggcg acggcgaaga cagcgacatt ggcgaatggg tgcacgccac gccaagcctg       420
     cgcgaacatc tgcaccagga gttgcgcagc taccgcctgt cgcagcgtga ttgcctgctg       480
     gggcagacgg tgatcgaggc gcttgacgac gacggctacc tgcgccaact gctctccgaa       540
     ctcattccgc ttgcgccggt ggaacctccg ccaaccgaga aggaaatgca gatcgccctg       600
     gcgctcgtgc agagcctcga tcccccgggc gtggcggcgc gcgacctgtc tgaatgcctg       660
     cgtctgcaga tcgaggcgcg gcccgccgac accgaggccg aggagcgcat ccaggaggtc       720
     gcccacgaca tcgtgcgcag ccacctgccc cgcctcgcca agcgcgaatt cacacagatg       780
     cgccgcgcgc tcggctgcac ggaagatgag cttcgcgatg cctgcgcgct cattcgcatg       840
     ctcgacccac gcccgggact gcgcttctcg caagcacacg cgggctacat cgtgcccgat       900
     gtgatcgtcg ccaagatccg gggcaagtgg atcgcggtga ccaacccggc ggtagcgccc       960
     tgcgcgcgca tcaacaaggt ctatgccgaa ctgtttgccc agacgcgcgg ctaccatcgc      1020
     acaccgctgg cgcaccagct gcaggaagcg cgctggctca tccgcaacgc gcagcagcgc      1080
     ttcgccacga tccaacgcgt ggcggaggcg atcgtcgcgc atcagaagca tttcctggag      1140
     tacggcgaag tggccatgaa accgctggtg ctgcgcgatg tggccgaaga actgggcttg      1200
     catgagtcca ccatttcacg cgcgaccggt aacaagtaca tggccacgcc gcgcggtatc      1260
     ttcgaattca agtatttctt ctcccggcaa ctggccaccg acacgggcgg cgcatgctcg      1320
     gctgcctcgg tgcgggcgct gctcaaggag atgatcgagg ccgaagacgc cgacgcaccg      1380
     ctctccgacg tgtcgctggc caagatgctg gccgagcagg gtgtgatcgt cgcgcgccgc      1440
     acggtcgcca agtaccgtgg gctgatgcgc attgcgccgg cggaaatgcg ccgccaggtc      1500
     tga                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page