(data stored in ACNUC7421 zone)

EMBL: CP001069.PE108

CP001069.PE108       Location/Qualifiers
FT   CDS_pept        124391..125287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3872"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein; SMART:
FT                   DEAD-like helicases; KEGG: ses:SARI_00228 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3872"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28984"
FT                   /db_xref="GOA:B2UHD3"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD3"
FT                   /protein_id="ACD28984.1"
FT                   /translation="MKTELPNEHGLSDGSLRHLLFYQDGKPSLSDIQHQGLVAGVARDT
FT                   SMLVVSPTSTGKTQLAVWAIAKGIENDCRTVYLVTHRALAKQKFDDFKSLFLSNFLSGN
FT                   PASLVLATGDSVEDSEGEFPPEPLKASLLVATYEKYLAMLSASGVPRDMSNTVVVCDEI
FT                   QLIGDKNRGQNVEILLTLLRNAGWRQFVGLSAVLPSRDAHDLADWLGVQLIMKATREKH
FT                   LSYRTAFSVTLCHPGVDPSVAPVVAACGRLCVVESVDLGEALLRYCEGSLSNDQLYRWL
FT                   ATPGQALAADLPFVERV"
     atgaaaactg aattgccaaa tgaacacggt ctttctgacg gctccttacg gcacttgttg        60
     ttttatcaag atgggaaacc ctctctcagc gatatccagc atcaaggtct cgtagccggg       120
     gtggctcgcg acacaagcat gttggttgtg tcaccgactt ccaccgggaa aacgcagctc       180
     gcggtctggg cgattgccaa gggtattgag aatgactgta gaacagttta cttggtaacc       240
     catcgggctt tagcaaagca gaagtttgac gatttcaaat cgctgttctt atcaaatttt       300
     ctgtctggca accccgcttc attagtgctc gcaaccggcg atagcgttga ggattctgag       360
     ggagagttcc ccccggaacc tctgaaagca tcgctcttag tggcgaccta tgagaaatat       420
     cttgccatgt tgtctgctag cggcgttccc cgggacatga gcaatacagt agttgtgtgc       480
     gacgagattc agctcattgg agacaagaat cgtggccaga acgtcgagat attgctaact       540
     cttcttcgca atgcgggttg gcgtcaattt gttgggttat ctgcagtttt gccttcccgc       600
     gatgcacacg atttggctga ctggctgggc gtgcaactaa ttatgaaggc aacccgcgaa       660
     aagcatctta gctatcgcac agcgtttagc gtaaccctgt gtcatcccgg tgtggatccg       720
     agcgttgcac ccgtggtagc tgcctgcggg cgcctttgtg ttgtggaaag tgtggatttg       780
     ggggaggcac tccttcgcta ttgcgaaggt tctctgtcga acgaccagct ttatcgatgg       840
     cttgcaacac ccgggcaagc tttggcggca gatctgccat tcgttgagcg cgtctaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page