(data stored in ACNUC7421 zone)

EMBL: CP001069.PE109

CP001069.PE109       Location/Qualifiers
FT   CDS_pept        125450..125953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3873"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3873"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28985"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD4"
FT                   /protein_id="ACD28985.1"
FT                   /translation="MGYHSFVDEFERICREHIREGRARAFAFIFYNMTHGLVRRALKST
FT                   NGFQVLNSASGKDLTVFYLHSGAVDGLSDNFNEKFLRILRVDEQITPPCIVFFRVNGEN
FT                   IEDLDFRAIDDEVGDSHLIVEELRRYISEYIDRINEQGNLSGISWIATEMLSGLLKKAL
FT                   LHAW"
     atgggctatc acagttttgt agatgagttt gagcgcattt gcagagagca catccgtgaa        60
     ggccgggccc gtgcattcgc atttattttt tataacatga cgcatgggct agttcgacgg       120
     gcgcttaaga gcacaaatgg tttccaagtt ttgaactctg catctggaaa ggatttgaca       180
     gtcttttatc tccactctgg tgcggttgat ggtttatcgg acaattttaa tgagaaattc       240
     ctcagaattt taagagtgga tgagcaaatt acaccgcctt gtattgtgtt ttttagagtg       300
     aatggagaga atattgagga ccttgatttc cgggccatag atgatgaggt aggggattcg       360
     caccttattg tggaggagtt gagaaggtat attagtgaat atatcgatcg aattaatgag       420
     cagggaaatt tgtcaggcat aagttggatc gccacagaga tgctgtctgg ccttctcaag       480
     aaggcgttgc tgcacgcgtg gtga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page