(data stored in ACNUC7421 zone)

EMBL: CP001069.PE110

CP001069.PE110       Location/Qualifiers
FT   CDS_pept        complement(126085..127125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3874"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_06818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3874"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28986"
FT                   /db_xref="InterPro:IPR041229"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD5"
FT                   /protein_id="ACD28986.1"
FT                   /translation="MSAQSTSTYLISLEFKNFSRDMEDHYKTIDPSIEAFWHKASKILR
FT                   QCEYTHNDCTITIDVGWQRMANRIRRDNDLLRPVRIGTPLDKKWFSKVSRPLKITAKVN
FT                   TINKNKYSDYKWYPSFFIEAFIHEFFLIANLSTPGSANFRSLFINSGNESRSTEVRLSS
FT                   FCFENGWVESLDGGWPTVEALPIEDVREWFQAISIGYKQRASTGIEKALYVLLHMAKDE
FT                   TRIDSVIWIFNGLEALVSTRVGESVSGLVRRLGMILDLDLPAQKKLNKEIRSLYDLRSS
FT                   FVHGGYAVPHPIHSEVIDRALDDDATKLYQLHQFGASLLISTIQALIKKKIINLRFDEF
FT                   MTVEKI"
     atgtcagcgc agtcaacttc gacttatcta atctcgctgg aatttaaaaa cttcagtcgg        60
     gatatggagg atcattacaa gaccatcgat ccatctatcg aagcgttttg gcacaaagca       120
     tcaaagatcc ttcgtcaatg cgaatacact cataacgact gcaccattac cattgacgtc       180
     gggtggcaac gcatggctaa tagaattcgg cgcgacaatg atctgctacg cccagttcga       240
     attggaaccc cacttgacaa aaaatggttc agcaaggttt ctcggccatt aaaaatcaca       300
     gccaaagtta atacaatcaa caaaaataaa tattcagatt acaagtggta tccgtctttt       360
     ttcatagaag catttatcca tgagttcttt ttaatcgcaa atttatccac cccaggctca       420
     gcgaattttc gttcactctt cataaattcc ggaaacgaat cccgatcgac agaggtaaga       480
     ctatcttcct tctgctttga gaatggctgg gttgaatctc ttgacggtgg atggccgaca       540
     gtggaagctc ttccaataga ggatgtacgc gagtggtttc aagcgatcag tattggctac       600
     aagcagagag ctagcaccgg gattgaaaaa gcactatacg ttttgctcca tatggcaaaa       660
     gatgagacga ggatcgactc tgtaatatgg atattcaatg gactcgaggc attggtatca       720
     actcgagttg gggaaagcgt gtcaggcctt gtgcgtcgac tgggaatgat cctggatctt       780
     gacttacctg cacagaaaaa gctcaacaaa gaaattcggt cactttatga tcttcgcagc       840
     tcttttgtgc atggtggtta tgcagtcccc catccaattc atagcgaggt aattgaccgg       900
     gcgctagacg acgatgcgac caaactgtac caactacatc agtttggcgc ctcgctgctt       960
     atttctacaa tccaagccct aataaagaag aaaatcataa atcttcgttt tgatgaattt      1020
     atgacggtcg aaaaaatttg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page