(data stored in ACNUC7421 zone)

EMBL: CP001069.PE113

CP001069.PE113       Location/Qualifiers
FT   CDS_pept        129908..132079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3879"
FT                   /product="PTS system, lactose/cellobiose family IIC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, lactose/cellobiose family IIC
FT                   subunit; PFAM: EAL domain protein; phosphotransferase
FT                   system EIIC; KEGG: dsy:DSY1020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3879"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28989"
FT                   /db_xref="GOA:B2UHD8"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD8"
FT                   /protein_id="ACD28989.1"
FT                   /translation="MTTQALSPWLRLLSAAERFDRGPYFIAIRRGLALSLPLIMVGAVA
FT                   LLLRNPPTAGMRHLLLEAFGTRLDAFCDSVLAGTIGIGSLVALFGFADVLAQLHNQRAG
FT                   HRVVNPTVAAVVVVSCFFTLIAPAANASLMAWLSLGQGLFGALVVASLGGSLFLKLCSI
FT                   RRLRIPSHHLSNDLLVGDVLSVVPAGMLTILTFALLKAGMAWAGWLHFMAIVDPLLAWP
FT                   YSAVSNSLLFGLGYETAAQVLWLFGIHGPNALYTVHQHILEPAAQANAAAVASGGQPPF
FT                   IFTYHFFAVFARMGGSGGTLSLILALLISRRMQRGRKMALVVMLPALFNVNEPLLFGLP
FT                   LVLNPVYAIPFLLTPVVQILIAYAATVADLMPKTSYPVAWTTPALFSGYAATGSVWGAV
FT                   VQLIGLVVGAAIYLPFVRMADVLSARRSQDVLASLLQIAESAEVSLKGRRCLDLPGDEG
FT                   RMAVALASDLEDAIKREGQIFLEFQPQVDCSTGRVFGAEALLRWQHPVLGRVASPIVVA
FT                   LADDIGQIDQLGLRILSLACQQRAAWRDVLPDDFVVAVNLSPRQLLDCRLYRNVLDILH
FT                   REGLSPTQLELEITESTMLLPDITAIGNLKQLREAGVKVALDDFGMGHTSLHYLRELPL
FT                   DTVKIDRSLADVSAGSVNEHIVRSIASLSRTLNLSTVVEGVETEQQLERLSALGCERFQ
FT                   GYFFSRPLAPSVCQQFVLDANLRPLVHAL"
     atgacgacgc aggcgctatc gccctggctg aggttgttga gcgccgctga gcgcttcgac        60
     cgcgggccgt atttcattgc cattcggcgc gggctggcgc tctcgttgcc gctcatcatg       120
     gtgggcgcgg tggcgctgct gttgcgcaac ccgcccaccg ccggcatgcg ccacctgctg       180
     ctggaggcct ttggcacgcg gctggatgcc ttttgcgaca gcgtgctggc cggcacgatc       240
     ggcatcggct cgctggtcgc gctgttcggg tttgccgatg tgttggcgca gttacacaac       300
     cagcgcgccg ggcaccgcgt ggtcaacccc accgtggcgg ccgtggtggt ggtgtcgtgc       360
     ttctttacgc tcatcgcgcc ggctgcgaac gcatcgttga tggcgtggct ctcgctgggg       420
     caggggctgt ttggcgcgtt ggtggtggcg tcgctgggcg gcagcctgtt tctcaagctg       480
     tgcagcatcc gccgtttgcg cattccgtcc caccatttga gcaacgatct gctggtgggc       540
     gatgtgctgt cggttgtgcc ggccggcatg ctgacgatcc tgacgtttgc cctgctcaaa       600
     gccggcatgg cgtgggcggg ctggctgcac ttcatggcga tagtcgaccc gctgctggcg       660
     tggccgtatt cggcagtctc caatagcctg ctgtttggtt tgggctatga gacggcggcg       720
     caggtgctct ggctgttcgg catccacggg ccgaacgcgc tgtacacggt gcaccagcac       780
     atcctggagc ccgccgcgca ggccaatgcg gcggcggttg ccagtggtgg ccagccgccg       840
     ttcatcttta cctatcactt cttcgcggtg ttcgcgcgca tgggcggctc aggcggcaca       900
     ctcagcctga tcttggcgct gctcatctcc aggcgcatgc aacgcggccg caagatggcg       960
     ctggtcgtca tgctgccggc attgttcaac gtgaacgagc ccctgctctt cgggctgccg      1020
     ctggtgctca acccggtcta tgcgattccg ttcctgctca cgccggtggt gcagatcctg      1080
     atcgcctatg cggccaccgt tgccgacctg atgcccaaga ccagctaccc cgtggcgtgg      1140
     accacgccgg cgctgttcag cggttacgcg gctacgggct cggtgtgggg ggcggtggtg      1200
     cagctcatcg gcctggtggt gggggcggcg atttacctgc cgtttgtccg catggcggat      1260
     gttctgtccg cacggcgcag tcaggatgtg cttgcgtctt tgctgcagat tgcggagtcg      1320
     gcggaggtga gcctgaaggg ccggcgctgt ctggacctgc cgggcgacga aggccgcatg      1380
     gcggtggcgc tggccagcga cctggaagac gccatcaaga gagaagggca gatctttctg      1440
     gagtttcagc cgcaggtgga ttgctcaacc gggcgcgtgt tcggcgccga ggcgctgctg      1500
     cgctggcagc atccggtgct ggggcgcgtg gcctcgccga tcgtcgtggc gctggctgat      1560
     gacattggtc agatcgatca gttgggcctg cggattctgt cgctcgcgtg tcagcagcgc      1620
     gcggcctggc gcgatgtctt gccggacgat ttcgtggtcg ccgtgaatct ctcacctcgg      1680
     cagttgctgg actgcaggct gtaccggaac gtgctcgaca tcctgcatcg cgaagggttg      1740
     tcgcccacgc agctcgaact ggagatcact gaatcgacga tgctgctgcc ggacatcacc      1800
     gccatcggca acctgaagca gctgcgcgag gccggcgtga aagtcgcgct cgacgatttc      1860
     gggatgggcc atacgtcgct gcactacctg cgcgagctgc cgctggatac cgtgaagatc      1920
     gaccgctcgc tggcagatgt gagcgcgggc agcgtcaacg aacacattgt gcgcagtatt      1980
     gccagcctga gccgcacgct gaacctgtcg acggtggtgg aaggcgtcga gacggagcag      2040
     cagcttgagc gcctgtcggc cttgggctgt gaacggtttc aggggtattt cttcagccgc      2100
     ccgctggcgc cgagcgtgtg tcagcagttt gtgctggatg ccaacctgcg gccgttggtg      2160
     cacgcgcttt ga                                                          2172
//

If you have problems or comments...

PBIL Back to PBIL home page