(data stored in SCRATCH zone)

EMBL: CP001069.PE133

CP001069.PE133       Location/Qualifiers
FT   CDS_pept        complement(149713..150606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3902"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bch:Bcen2424_3766 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3902"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29009"
FT                   /db_xref="GOA:B2UHF8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHF8"
FT                   /protein_id="ACD29009.1"
FT                   /translation="MNNLRRLDLNLLVTLDVLLTEHNVTRAAERLNFSQPSVSVHLAKL
FT                   RDIFGDPLLLPGPRGMRPTARAESLREPLRLALEALEQAVAPASPFDPAHATNTWRVAA
FT                   TDYGESTIALPVLNTLRTSAPGTRLAMLGLVPTRIEKQAEQGEIDLAFHTTDGAPPGLR
FT                   RRALFTERYVLIGRAGHPRLKRRPTLAQFCTLDHVIVSPDGGGFFGVTDEALAAAGATR
FT                   RVVLSVPHFLFVMTAVASTDMVAMLPERLVRGASALQAVEPPVEVPGYEMSMLWHERVH
FT                   RDPGHQWLRDVIAGAV"
     atgaataatc tcaggcggtt ggacctgaac ctgctggtga cactcgatgt gctgctgacc        60
     gagcacaacg tcacgcgtgc ggccgagcgg ctgaacttct cgcagccttc cgtgagcgtg       120
     catctggcca agttgcgaga catttttggt gacccgctac tgctgcccgg cccgcgcggc       180
     atgcgcccaa ccgcccgcgc ggaaagcttg cgcgaaccgc tgcggctggc gctggaagcg       240
     ctggagcagg ccgtcgcacc cgccagcccg ttcgacccgg cgcacgccac caacacctgg       300
     cgcgtggccg ccacggacta cggcgaatcg accatcgcgc tgccggtgct gaacaccctg       360
     cgcacaagcg caccgggcac acggctcgcc atgctgggac tggtgcccac gcgtattgaa       420
     aagcaagccg agcaagggga gatcgacctc gcgttccaca ccacagacgg cgcgccaccc       480
     ggcctgcgcc gccgtgcgct cttcactgaa cgctatgtgt tgatcggccg cgcggggcac       540
     ccgcgcctga agcgcaggcc gacactggcg cagttttgca cgctcgatca cgtgatcgtg       600
     tcgcccgatg gcggtggctt cttcggcgtg acggacgaag ccctggcggc agccggtgcc       660
     acgcgacgcg tagtgctgtc ggtgccgcac ttcctctttg tgatgacagc ggtggcaagc       720
     actgacatgg tcgccatgct gcccgagcgg ctggtgcgcg gggccagtgc gctacaggcg       780
     gttgaaccgc cggtggaggt gccaggctat gagatgtcga tgctgtggca tgagcgcgtg       840
     catcgagacc ccgggcatca gtggttgcgt gatgtgattg caggcgcggt ctga             894
//

If you have problems or comments...

PBIL Back to PBIL home page